Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LG Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

CD300 molecule like family member g

Gene Aliases

CD300 antigen-like family member G; CLM9; CLM-9; CMRF35-like molecule 9; NEPMUCIN; TREM4; TREM-4; triggering receptor expressed on myeloid cells 4.

Gene ID

146894

Swiss Prot

Q6UXG3

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human CD300LG.

Target

Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

36 kda

Specificity

CD300LG Antibody detects endogenous levels of CD300LG protein.

NCBI Gene Symbol

CD300LG

Host or Source

Rabbit

Protein Name

CMRF35-like molecule 9

Gene Name URL

CD300LG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb3d CRISPR/Cas9 KO Plasmid (m)
sc-436493 20 µg

Serpinb3d CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
TIP39 Double Nickase Plasmid (h)
sc-405791-NIC 20 µg

TIP39 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
IKK, alpha/beta, ID (S176/180) (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (MaxL
MBS6309656-01 0.1 mL

IKK, alpha/beta, ID (S176/180) (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (MaxL

Sign In for Pricing
View Details
IKK, alpha/beta, ID (S176/180) (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (MaxL
MBS6309656-02 5x 0.1 mL

IKK, alpha/beta, ID (S176/180) (CHUK, IKKA, TCF16, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha, Transcription factor 16) (MaxL

Sign In for Pricing
View Details
ENAM (Enamelin) (MaxLight 405)
MBS6189984-01 0.1 mL

ENAM (Enamelin) (MaxLight 405)

Sign In for Pricing
View Details
ENAM (Enamelin) (MaxLight 405)
MBS6189984-02 5x 0.1 mL

ENAM (Enamelin) (MaxLight 405)

Sign In for Pricing
View Details