Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPRJ Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine phosphatase receptor type J

Gene Aliases

CD148; CD148 antigen; density-enhanced phosphatase 1; DEP1; DEP-1; HPTP eta; HPTPeta; human density enhanced phosphatase-1; protein tyrosine phosphatase, receptor type, J polypeptide; protein-tyrosine phosphatase eta; Protein-tyrosine phosphatase receptor type J; receptor-type tyrosine-protein phosphatase eta; R-PTP-ETA; R-PTP-J; SCC1; susceptibility to colon cancer 1, mouse, homolog of.

Gene ID

5795

Swiss Prot

Q12913

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human PTPRJ.

Target

Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSEVLKYEIDVGN

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

145 kDa

Specificity

PTPRJ Antibody detects endogenous levels of PTPRJ protein.

NCBI Gene Symbol

PTPRJ

Host or Source

Rabbit

Protein Name

Receptor-type tyrosine-protein phosphatase eta

Gene Name URL

PTPRJ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BACH1 Antibody
NBP1-71814 100 µL

Rabbit Polyclonal BACH1 Antibody

Sign In for Pricing
View Details
MYH1 Polyclonal Antibody
E-AB-14234-01 20 µL

MYH1 Polyclonal Antibody

Sign In for Pricing
View Details
MYH1 Polyclonal Antibody
E-AB-14234-02 60 µL

MYH1 Polyclonal Antibody

Sign In for Pricing
View Details
MYH1 Polyclonal Antibody
E-AB-14234-03 120 µL

MYH1 Polyclonal Antibody

Sign In for Pricing
View Details
MYH1 Polyclonal Antibody
E-AB-14234-04 200 µL

MYH1 Polyclonal Antibody

Sign In for Pricing
View Details
APC/Cy7 Anti-human CD57 Antibody *HI57a*
105701D2-AAT 500 Tests

APC/Cy7 Anti-human CD57 Antibody *HI57a*

Sign In for Pricing
View Details