Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Leukocyte immunoglobulin like receptor A4

Gene Aliases

CD85 antigen-like family member G; CD85g; ILT7; immunoglobulin-like transcript 7; leucocyte Ig-like receptor A4; leukocyte immunoglobulin-like receptor subfamily A member 4; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 4.

Gene ID

23547

Swiss Prot

P59901

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human LILRA4.

Target

Functions coreceptor to limit the innate immune responses to viral infections; signaling occurs via FCER1G (PubMed:16735691, PubMed:19564354) . Down-regulates the production of IFNA1, IFNA2, IFNA4, IFNB1 and TNF by plasmacytoid dendritic cells that have been exposed to influenza virus or cytidine-phosphate-guanosine (CpG) dinucleotides, indicating it functions as negative regulator of TLR7 and TLR9 signaling cascades (PubMed:16735691, PubMed:19564354, PubMed:24586760) . Down-regulates interferon production in response to interaction with BST2 on HIV-1 infected cells (PubMed:26172439) . Activates a signaling cascade in complex with FCER1G that results in phosphorylation of Src family and Syk kinases and thereby triggers mobilization of intracellular Ca (2+) (PubMed:16735691, PubMed:19564354) . Does not interfere with the differentiation of plasmacytoid dendritic cells into antigen-presenting cells (PubMed:24586760) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GTYRCYGSRSSNPYLLSHPSEPLELVVSGATETLNPAQKKSDSKTAPHLQ

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

55 kDa

Specificity

LILRA4 Antibody detects endogenous levels of LILRA4 protein.

NCBI Gene Symbol

LILRA4

Host or Source

Rabbit

Protein Name

Leukocyte immunoglobulin-like receptor subfamily A member 4

Gene Name URL

LILRA4

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Maleic hydrazide monoclonal antibody, clone MH
CABT-ZB028 1 mg

Mouse Anti-Maleic hydrazide monoclonal antibody, clone MH

Sign In for Pricing
View Details
Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit
MBS7222970-01 48 Well

Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit
MBS7222970-02 96 Well

Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit
MBS7222970-03 5x 96 Well

Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit
MBS7222970-04 10x 96 Well

Mouse Olfactory receptor 2C1 (OR2C1) ELISA Kit

Sign In for Pricing
View Details
Rabbit CXCL16 (Chemokine C-X-C-Motif Ligand 16) ValidElisa Kit
EK346232 96 Well

Rabbit CXCL16 (Chemokine C-X-C-Motif Ligand 16) ValidElisa Kit

Sign In for Pricing
View Details