Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

C-C motif chemokine ligand 4|C-C motif chemokine ligand 4 like 1|C-C motif chemokine ligand 4 like 2

Gene Aliases

ACT2; AT744.1; AT744.2; CC chemokine ligand 4L1; C-C motif chemokine 4; C-C motif chemokine 4-like; CCL4L; chemokine (C-C motif) ligand 4; chemokine (C-C motif) ligand 4-like 1, telomeric; chemokine (C-C motif) ligand 4-like 2; G-26; G-26 T-lymphocyte-secreted protein; HC21; LAG1; LAG-1; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; macrophage inflammatory protein-1b2; MIP1B; MIP1B1; MIP-1-beta; MIP-1-beta (1-69) ; Monocyte adherence-induced protein 5-alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; secreted protein G-26; SIS-gamma; small inducible cytokine A4 (homologous to mouse Mip-1b) ; small inducible cytokine A4-like; Small-inducible cytokine A4; Small-inducible cytokine A4-like; T-cell activation protein 2.

Gene ID

388372|6351|9560

Swiss Prot

P13236

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human CCL4.

Target

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) . The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta (3-69) is also a ligand for CCR1 and CCR2 isoform B.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLE

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

10 kDa

Specificity

CCL4 Antibody detects endogenous levels of CCL4 protein.

NCBI Gene Symbol

CCL4|CCL4L1|CCL4L2

Host or Source

Rabbit

Protein Name

C-C motif chemokine 4

Gene Name URL

CCL4|CCL4L1|CCL4L2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3.3A (H3F3A) Rabbit Polyclonal Antibody
TA384374 100 µL

H3.3A (H3F3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr355 Recombinant Protein (Mouse)
RP157682 100 µg

Olfr355 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
HnRNP C1/C2 Rabbit mAb
E2R381235 100 µL

HnRNP C1/C2 Rabbit mAb

Sign In for Pricing
View Details
SH3TC2 discontinued
542256-01 30ul

SH3TC2 discontinued

Sign In for Pricing
View Details
SH3TC2 discontinued
542256-02 100 µL

SH3TC2 discontinued

Sign In for Pricing
View Details
NTE Polyclonal Antibody
E44H06805 100 µL

NTE Polyclonal Antibody

Sign In for Pricing
View Details