What is the catalog number for CCL4 Antibody?

The catalog number for CCL4 Antibody is OAAF08039-100UG.

What sizes are available for CCL4 Antibody?

CCL4 Antibody is available in the following size(s): 100 µg.

Is CCL4 Antibody in stock?

CCL4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

CCL4 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

C-C motif chemokine ligand 4|C-C motif chemokine ligand 4 like 1|C-C motif chemokine ligand 4 like 2

Gene Aliases

ACT2; AT744.1; AT744.2; CC chemokine ligand 4L1; C-C motif chemokine 4; C-C motif chemokine 4-like; CCL4L; chemokine (C-C motif) ligand 4; chemokine (C-C motif) ligand 4-like 1, telomeric; chemokine (C-C motif) ligand 4-like 2; G-26; G-26 T-lymphocyte-secreted protein; HC21; LAG1; LAG-1; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; macrophage inflammatory protein-1b2; MIP1B; MIP1B1; MIP-1-beta; MIP-1-beta (1-69) ; Monocyte adherence-induced protein 5-alpha; PAT 744; Protein H400; SCYA2; SCYA4; SCYA4L; SCYA4L1; SCYA4L2; SCYQ4L2; secreted protein G-26; SIS-gamma; small inducible cytokine A4 (homologous to mouse Mip-1b) ; small inducible cytokine A4-like; Small-inducible cytokine A4; Small-inducible cytokine A4-like; T-cell activation protein 2.

Gene ID

388372|6351|9560

Swiss Prot

P13236

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from the Internal region of human CCL4.

Target

Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV) . The processed form MIP-1-beta (3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta (3-69) is also a ligand for CCR1 and CCR2 isoform B.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLE

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol