Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WEE2 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

WEE2 oocyte meiosis inhibiting kinase

Gene Aliases

OOMD5; WEE1 homolog 2; WEE1B; wee1B kinase; wee1-like protein kinase 1B; wee1-like protein kinase 2.

Gene ID

494551

Swiss Prot

P0C1S8

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human WEE2.

Target

Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1 and acts as a key regulator of meiosis during both prophase I and metaphase II. Required to maintain meiotic arrest in oocytes during the germinal vesicle (GV) stage, a long period of quiescence at dictyate prophase I, by phosphorylating CDK1 at 'Tyr-15', leading to inhibit CDK1 activity and prevent meiotic reentry. Also required for metaphase II exit during egg activation by phosphorylating CDK1 at 'Tyr-15', to ensure exit from meiosis in oocytes and promote pronuclear formation (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALVNINPFTPESYKKLFLQSGGKRKIRGDLEEAGPEEGKGGLPAKRCVLR

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

62 kDa

Notes

Formerly GWB-ASF089

Specificity

WEE2 Antibody detects endogenous levels of total WEE2 protein.

NCBI Gene Symbol

WEE2

Host or Source

Rabbit

Protein Name

Wee1-like protein kinase 2

Gene Name URL

WEE2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIB sgRNA CRISPR Lentivector (Human) (Target 1)
K1422102 1.0 µg DNA

NFIB sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit
MBS2616017-01 48 Well

Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit

Sign In for Pricing
View Details
Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit
MBS2616017-02 96 Well

Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit

Sign In for Pricing
View Details
Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit
MBS2616017-03 5x 96 Well

Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit

Sign In for Pricing
View Details
Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit
MBS2616017-04 10x 96 Well

Canine Signal Transducer And Activator Of Transcription 5B (STAT5B) ELISA Kit

Sign In for Pricing
View Details
O52H1 Rabbit Polyclonal Antibody
E28PN2725 100 µL

O52H1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details