Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGDIA Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Rho GDP dissociation inhibitor alpha

Gene Aliases

Epididymis secretory sperm binding protein Li 47e; GDIA1; GDP-dissociation inhibitor, aplysia RAS-related 1; HEL-S-47e; NPHS8; Rho GDP dissociation inhibitor (GDI) alpha; rho GDP-dissociation inhibitor 1; RHOGDI; Rho-GDI alpha; RHOGDI-1.

Gene ID

396

Swiss Prot

P52565

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human ARHGDIA.

Target

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

23 kDa

Notes

Formerly GWB-ASC586

Specificity

ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein.

NCBI Gene Symbol

ARHGDIA

Host or Source

Rabbit

Protein Name

Rho GDP-dissociation inhibitor 1

Gene Name URL

ARHGDIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR36 Antibody Picoband®, FITC Conjugate
A05779-1-FITC 100 µg/Vial

Anti-WDR36 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Fam118a AAV siRNA Pooled Vector
19731166 1.0 µg

Fam118a AAV siRNA Pooled Vector

Sign In for Pricing
View Details
BAG2 (BAG Family Molecular Chaperone Regulator 2, BCL2-Associated Athanogene 2)
476077 100 µL

BAG2 (BAG Family Molecular Chaperone Regulator 2, BCL2-Associated Athanogene 2)

Sign In for Pricing
View Details
Anti-IFN gamma Receptor beta/AF-1/IFNGR2 Antibody Picoband® Fluoro488 Conjugated
A03158-2-Fluoro488 100 µg/Vial

Anti-IFN gamma Receptor beta/AF-1/IFNGR2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Purified Mouse Anti-human HLA-G Antibody *01G, monoclonal, Cross Adsorbed*
V1031140-AAT 0.1 mg

Purified Mouse Anti-human HLA-G Antibody *01G, monoclonal, Cross Adsorbed*

Sign In for Pricing
View Details
PHF17 Antibody
25-226 100 µL

PHF17 Antibody

Sign In for Pricing
View Details