Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Artemis Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

DNA cross-link repair 1C

Gene Aliases

A-SCID; DCLREC1C; DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) ; DNA cross-link repair 1C protein; protein artemis; Protein A-SCID; RS-SCID; SCIDA; severe combined immunodeficiency, type a (Athabascan) ; SNM1 homolog C; SNM1C; SNM1-like protein.

Gene ID

64421

Swiss Prot

Q96SD1

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Artemis.

Target

Required for V (D) J recombination, the process by which exons encoding the antigen-binding domains of immunoglobulins and T-cell receptor proteins are assembled from individual V, (D), and J gene segments. V (D) J recombination is initiated by the lymphoid specific RAG endonuclease complex, which generates site specific DNA double strand breaks (DSBs) . These DSBs present two types of DNA end structures: hairpin sealed coding ends and phosphorylated blunt signal ends. These ends are independently repaired by the non homologous end joining (NHEJ) pathway to form coding and signal joints respectively. This protein exhibits single-strand specific 5'-3' exonuclease activity in isolation and acquires endonucleolytic activity on 5' and 3' hairpins and overhangs when in a complex with PRKDC. The latter activity is required specifically for the resolution of closed hairpins prior to the formation of the coding joint. May also be required for the repair of complex DSBs induced by ionizing radiation, which require substantial end-processing prior to religation by NHEJ.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTH

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

78 kDa

Notes

Formerly GWB-ASC162

Specificity

Artemis Antibody detects endogenous levels of total Artemis protein.

NCBI Gene Symbol

DCLRE1C

Host or Source

Rabbit

Protein Name

Protein artemis

Gene Name URL

DCLRE1C

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-binding factor 3
AP83953-01 50 µg

GATA-binding factor 3

Sign In for Pricing
View Details
GATA-binding factor 3
AP83953-02 100 µg

GATA-binding factor 3

Sign In for Pricing
View Details
GATA-binding factor 3
AP83953-03 1 mg

GATA-binding factor 3

Sign In for Pricing
View Details
DNMT3B antibody
70R-49668 100 µL

DNMT3B antibody

Sign In for Pricing
View Details
SH3BGRL3 (SH3 domain-binding glutamic acid-rich-like protein 3, SH3 domain-binding protein 1, SH3BP-1, P1725)
334132 100 µL

SH3BGRL3 (SH3 domain-binding glutamic acid-rich-like protein 3, SH3 domain-binding protein 1, SH3BP-1, P1725)

Sign In for Pricing
View Details
Rabbit Polyclonal CALHM1 Antibody
TA590770 100 µg

Rabbit Polyclonal CALHM1 Antibody

Sign In for Pricing
View Details