Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNK1 Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

WNK lysine deficient protein kinase 1

Gene Aliases

Erythrocyte 65 kDa protein; HSAN2; HSN2; KDP; Kinase deficient protein; p65; PPP1R167; PRKWNK1; prostate-derived sterile 20-like kinase; Protein kinase lysine-deficient 1; protein kinase with no lysine 1; protein phosphatase 1, regulatory subunit 167; PSK; serine/threonine-protein kinase WNK1; serine/threonine-protein kinase WNK1 1; serine/threonine-protein kinase WNK1 2.

Gene ID

65125

Swiss Prot

Q9H4A3

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human WNK1.

Target

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

APKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTT

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

250 kDa

Notes

Formerly GWB-ASC113

Specificity

WNK1 Antibody detects endogenous levels of total WNK1 protein.

NCBI Gene Symbol

WNK1

Host or Source

Rabbit

Protein Name

Serine/threonine-protein kinase WNK1

Gene Name URL

WNK1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LLPH Rabbit pAb
orb2713166-01 50 µL

LLPH Rabbit pAb

Sign In for Pricing
View Details
LLPH Rabbit pAb
orb2713166-02 100 µL

LLPH Rabbit pAb

Sign In for Pricing
View Details
Setanaxib (GKT137831)
C12499-01 5 mg

Setanaxib (GKT137831)

Sign In for Pricing
View Details
Setanaxib (GKT137831)
C12499-02 10 mM / 1 mL

Setanaxib (GKT137831)

Sign In for Pricing
View Details
Setanaxib (GKT137831)
C12499-03 25 mg

Setanaxib (GKT137831)

Sign In for Pricing
View Details
Setanaxib (GKT137831)
C12499-04 100 mg

Setanaxib (GKT137831)

Sign In for Pricing
View Details