Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFAT3 Antibody (Phospho-Ser168+Ser170)

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear factor of activated T cells 4

Gene Aliases

NFAT3; NF-AT3; NF-ATC4; nuclear factor of activated T-cells, cytoplasmic 4; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4; T-cell transcription factor NFAT3.

Gene ID

4776

Swiss Prot

Q14934

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human NFAT3 around the phosphorylation site of Ser168 and Ser170.

Target

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDA

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1 mg/ml

Format

Liquid// PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide

Reconstitution

-20°C

Molecular Weight

95 kDa

Notes

Formerly GWB-ASC001

Specificity

Phospho-NFATc4 (S168/S170) Polyclonal Antibody detects endogenous levels of NFATc4 protein only when phosphorylated at S168/S170.

NCBI Gene Symbol

NFATC4

Host or Source

Rabbit

Protein Name

Nuclear factor of activated T-cells, cytoplasmic 4

Gene Name URL

NFATC4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), 1mg/mL
BNUM1037-50 1x 50 µL

CD44 Standard (DF1485), 1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL
BNC400696-100 1x 100 µL

Cytokeratin 10/13 (DE-K13), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL
BNC041365-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL
BNC401188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details