Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFRa Antibody (Phospho-Tyr849)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Platelet derived growth factor receptor alpha

Gene Aliases

Alpha platelet-derived growth factor receptor; alpha-type platelet-derived growth factor receptor; CD140 antigen-like family member A; CD140A; CD140a antigen; PDGFR2; PDGFR-2; PDGF-R-alpha; Platelet-derived growth factor alpha receptor; platelet-derived growth factor receptor 2; platelet-derived growth factor receptor alpha; platelet-derived growth factor receptor, alpha polypeptide.

Gene ID

5156

Swiss Prot

P16234

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human PDGFRa around the phosphorylation site of Tyr849.

Target

Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development and cephalic closure during embryonic development. Required for normal development of the mucosa lining the gastrointestinal tract, and for recruitment of mesenchymal cells and normal development of intestinal villi. Plays a role in cell migration and chemotaxis in wound healing. Plays a role in platelet activation, secretion of agonists from platelet granules, and in thrombin-induced platelet aggregation. Binding of its cognate ligands - homodimeric PDGFA, homodimeric PDGFB, heterodimers formed by PDGFA and PDGFB or homodimeric PDGFC -leads to the activation of several signaling cascades; the response depends on the nature of the bound ligand and is modulated by the formation of heterodimers between PDGFRA and PDGFRB. Phosphorylates PIK3R1, PLCG1, and PTPN11. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, mobilization of cytosolic Ca (2+) and the activation of protein kinase C. Phosphorylates PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and thereby mediates activation of the AKT1 signaling pathway. Mediates activation of HRAS and of the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3 and STAT5A and/or STAT5B. Receptor signaling is down-regulated by protein phosphatases that dephosphorylate the receptor and its down-stream effectors, and by rapid internalization of the activated receptor.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPE

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

122 kDa

Notes

Formerly GWB-ASB934

Specificity

PDGFRa (Phospho-Tyr849) Antibody detects endogenous levels of PDGFRa only when phosphorylated at Tyr849.

NCBI Gene Symbol

PDGFRA

Host or Source

Rabbit

Protein Name

Platelet-derived growth factor receptor alpha

Gene Name URL

PDGFRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp804a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3676308 1.0 µg DNA

Zfp804a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-DcR3  (1F1)
YF-MA16511 100 ug

Anti-DcR3 (1F1)

Sign In for Pricing
View Details
AFAP Rabbit Polyclonal Antibody (Biotin)
orb459850 100 µL

AFAP Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Itln1 Mouse shRNA Plasmid (Locus ID 16429)
TR516509 1 Kit

Itln1 Mouse shRNA Plasmid (Locus ID 16429)

Sign In for Pricing
View Details
R3HCC1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1767502 1.0 µg DNA

R3HCC1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2141020-01 0.1 mL

HRP-Linked Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details