Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT4 Antibody (Phospho-Tyr693)

Product Specifications

CAS Number

9007-83-4

Gene Name

Signal transducer and activator of transcription 4

Gene Aliases

Signal transducer and activator of transcription 4; signal transducer and activator of transcription 4 variant 3; SLEB11.

Gene ID

6775

Swiss Prot

Q14765

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human STAT4 around the phosphorylation site of Tyr693.

Target

Carries out a dual function: signal transduction and activation of transcription. Involved in IL12 signaling.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDST

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

85 kDa

Notes

Formerly GWB-ASB811

Specificity

STAT4 (Phospho-Tyr693) Antibody detects endogenous levels of STAT4 only when phosphorylated at Tyr693.

NCBI Gene Symbol

STAT4

Host or Source

Rabbit

Protein Name

Signal transducer and activator of transcription 4

Gene Name URL

STAT4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)
abx348123-01 20 µg

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)

Sign In for Pricing
View Details
CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)
abx348123-02 50 µg

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)

Sign In for Pricing
View Details
CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)
abx348123-03 100 µg

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)

Sign In for Pricing
View Details
CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)
abx348123-04 200 µg

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)

Sign In for Pricing
View Details
CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)
abx348123-05 1 mg

CCA tRNA nucleotidyltransferase 1, mitochondrial (TRNT1) Antibody (HRP)

Sign In for Pricing
View Details
CD64 (CD 64, CD64 Antigen, CD64A, Fc Fragment of IgG High Affinity Ia Receptor, Fc Fragment of IgG High Affinity Ib Receptor, Fc Fragment of IgG High Affinity Ic Receptor, Fc gamma Receptor, Fc gamma Receptor I, Fc gamma RI, FCG 1, FCG1, FCGR 1, FCGR1, FcRI, Fc gamma Receptor I A1, FCGR1A, Fc gamma Receptor I B2, FCGR1B, Fc of IgG High Affinity Ia Receptor, FCGR1C, High Affinity Immunoglobulin gamma Fc Receptor I, IGFR 1, IGFR1, IGFRB, IGFRC, IgG Fc Receptor I) (PE, Cy5) discontinued
C2419-06F2 100 Tests

CD64 (CD 64, CD64 Antigen, CD64A, Fc Fragment of IgG High Affinity Ia Receptor, Fc Fragment of IgG High Affinity Ib Receptor, Fc Fragment of IgG High Affinity Ic Receptor, Fc gamma Receptor, Fc gamma Receptor I, Fc gamma RI, FCG 1, FCG1, FCGR 1, FCGR1, FcRI, Fc gamma Receptor I A1, FCGR1A, Fc gamma Receptor I B2, FCGR1B, Fc of IgG High Affinity Ia Receptor, FCGR1C, High Affinity Immunoglobulin gamma Fc Receptor I, IGFR 1, IGFR1, IGFRB, IGFRC, IgG Fc Receptor I) (PE, Cy5) discontinued

Sign In for Pricing
View Details