Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYK2 Antibody (Phospho-Tyr402)

Product Specifications

CAS Number

9007-83-4

Gene Name

Protein tyrosine kinase 2 beta

Gene Aliases

CADTK; CAKB; CAK-beta; calcium-dependent tyrosine kinase; calcium-regulated non-receptor proline-rich tyrosine kinase; cell adhesion kinase beta; FADK 2; FADK2; FAK2; focal adhesion kinase 2; PKB; proline-rich tyrosine kinase 2; protein kinase B; protein-tyrosine kinase 2-beta; PTK; PTK2B protein tyrosine kinase 2 beta; PYK2; RAFTK; related adhesion focal tyrosine kinase.

Gene ID

2185

Swiss Prot

Q14289

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human PYK2 around the phosphorylation site of Tyr402.

Target

Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is required for normal levels of marginal B-cells in the spleen and normal migration of splenic B-cells. Required for normal macrophage polarization and migration towards sites of inflammation. Regulates cytoskeleton rearrangement and cell spreading in T-cells, and contributes to the regulation of T-cell responses. Promotes osteoclastic bone resorption; this requires both PTK2B/PYK2 and SRC. May inhibit differentiation and activity of osteoprogenitor cells. Functions in signaling downstream of integrin and collagen receptors, immune receptors, G-protein coupled receptors (GPCR), cytokine, chemokine and growth factor receptors, and mediates responses to cellular stress. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. Promotes activation of NOS3. Regulates production of the cellular messenger cGMP. Promotes activation of the MAP kinase signaling cascade, including activation of MAPK1/ERK2, MAPK3/ERK1 and MAPK8/JNK1. Promotes activation of Rho family GTPases, such as RHOA and RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Acts as a scaffold, binding to both PDPK1 and SRC, thereby allowing SRC to phosphorylate PDPK1 at 'Tyr-9, 'Tyr-373', and 'Tyr-376'. Promotes phosphorylation of NMDA receptors by SRC family members, and thereby contributes to the regulation of NMDA receptor ion channel activity and intracellular Ca (2+) levels. May also regulate potassium ion transport by phosphorylation of potassium channel subunits. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ASAP1, NPHP1, KCNA2 and SHC1. Promotes phosphorylation of ASAP2, RHOU and PXN; this requires both SRC and PTK2/PYK2.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQY

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

115 kDa

Notes

Formerly GWB-ASB791

Specificity

PYK2 (Phospho-Tyr402) Antibody detects endogenous levels of PYK2 only when phosphorylated at Tyr402.

NCBI Gene Symbol

PTK2B

Host or Source

Rabbit

Protein Name

Protein-tyrosine kinase 2-beta

Gene Name URL

PTK2B

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Zfp509 (BC028988) Mouse Untagged Clone
MC217911 10 µg

Zfp509 (BC028988) Mouse Untagged Clone

Ask
View Details
Recombinant Human ARHGAP31 Protein
E30P9235 20 µg

Recombinant Human ARHGAP31 Protein

Ask
View Details
Collagen IV Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-42306R-BF350 100 µL

Collagen IV Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Ask
View Details
Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)
MBS1074336-01 0.02 mg (E-Coli)

Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)

Ask
View Details
Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)
MBS1074336-02 0.1 mg (E-Coli)

Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)

Ask
View Details
Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)
MBS1074336-03 0.02 mg (Yeast)

Recombinant Haemophilus ducreyi 10 kDa chaperonin (groS)

Ask
View Details