Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF-kappaB p65 Antibody (Phospho-Ser276)

Product Specifications

CAS Number

9007-83-4

Gene Name

RELA proto-oncogene, NF-kB subunit

Gene Aliases

CMCU; NF-kappa-B p65delta3; NF-kappa-B transcription factor p65; NFKB3; nuclear factor NF-kappa-B p65 subunit; nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; p65; transcription factor p65; v-rel avian reticuloendotheliosis viral oncogene homolog A.

Gene ID

5970

Swiss Prot

Q04206

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human NF-kappaB p65 around the phosphorylation site of Ser276.

Target

NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52 and the heterodimeric p65-p50 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. NF-kappa-B heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kappa-B p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of I-kappa-B upon NF-kappa-B the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. Associates with chromatin at the NF-kappa-B promoter region via association with DDX1. Essential for cytokine gene expression in T-cells (PubMed:15790681) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRI

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

60 kDa

Notes

Formerly GWB-ASB756

Specificity

NF-kappaB p65 (Phospho-Ser276) Antibody detects endogenous levels of NF-kappaB p65 only when phosphorylated at Ser276.

NCBI Gene Symbol

RELA

Host or Source

Rabbit

Protein Name

Transcription factor p65

Gene Name URL

RELA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pbdc1 (NM_001108818) Rat Tagged ORF Clone Lentiviral Particle
RR203055L3V 200 µL

Pbdc1 (NM_001108818) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal KIF2C Antibody (KIF2C/4706) [CoraFluor 1]
NBP3-20782CL1 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/4706) [CoraFluor 1]

Sign In for Pricing
View Details
Rabbit Polyclonal BHLHB5 Antibody
NBP2-39039-25ul 25 µL

Rabbit Polyclonal BHLHB5 Antibody

Sign In for Pricing
View Details
Ank3 3'UTR Luciferase Stable Cell Line
TU101793 1.0 mL

Ank3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human BLOC1S6 Recombinant Protein (N-His)
HP802022-01 50 µg

Human BLOC1S6 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human BLOC1S6 Recombinant Protein (N-His)
HP802022-02 100 µg

Human BLOC1S6 Recombinant Protein (N-His)

Sign In for Pricing
View Details