Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAK2 Antibody (Phospho-Tyr1007)

Product Specifications

CAS Number

9007-83-4

Gene Name

Janus kinase 2

Gene Aliases

JAK-2; Janus kinase 2; Janus kinase 2 (a protein tyrosine kinase) ; JTK10; tyrosine-protein kinase JAK2.

Gene ID

3717

Swiss Prot

O60674

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human JAK2 around the phosphorylation site of Tyr1007.

Target

Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO) ; or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins (PubMed:7615558) . Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins (PubMed:9618263) . Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain. Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B) (PubMed:21368206) . In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation (PubMed:20098430) . Plays a role in cell cycle by phosphorylating CDKN1B (PubMed:21423214) . Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin (PubMed:19783980) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

130 kDa

Notes

Formerly GWB-ASB713

Fragment

IgG

Specificity

JAK2 (Phospho-Tyr1007) Antibody detects endogenous levels of JAK2 only when phosphorylated at Tyr1007.

NCBI Gene Symbol

JAK2

Host or Source

Rabbit

Protein Name

Tyrosine-protein kinase JAK2

Gene Name URL

JAK2

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit
MBS3809143-01 48 Well

Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit

Ask
View Details
Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit
MBS3809143-02 96 Well

Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit

Ask
View Details
Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit
MBS3809143-03 5x 96 Well

Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit

Ask
View Details
Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit
MBS3809143-04 10x 96 Well

Rat Granulocyte Colony Stimulating Factor Antibody ELISA Kit

Ask
View Details
Influenza A H5N1 (A/bar-headed goose/Qinghai/1A/2005) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
MBS8115862-01 0.3 mg

Influenza A H5N1 (A/bar-headed goose/Qinghai/1A/2005) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)

Ask
View Details
Influenza A H5N1 (A/bar-headed goose/Qinghai/1A/2005) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
MBS8115862-02 5x 0.3 mg

Influenza A H5N1 (A/bar-headed goose/Qinghai/1A/2005) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)

Ask
View Details