Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKK-alpha Antibody (Phospho-Thr23)

Product Specifications

CAS Number

9007-83-4

Gene Name

Component of inhibitor of nuclear factor kappa B kinase complex

Gene Aliases

BPS2; conserved helix-loop-helix ubiquitous kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; IkB kinase alpha subunit; IKBKA; IKK1; IKKA; IKK-a kinase; IKK-alpha; inhibitor of nuclear factor kappa-B kinase subunit alpha; NFKBIKA; Nuclear factor NFkappaB inhibitor kinase alpha; Nuclear factor NF-kappa-B inhibitor kinase alpha; TCF16; TCF-16; transcription factor 16.

Gene ID

1147

Swiss Prot

O15111

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human IKK-alpha around the phosphorylation site of Thr23.

Target

Serine kinase that plays an essential role in the NF-kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damages or other cellular stresses. Acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Negatively regulates the pathway by phosphorylating the scaffold protein TAXBP1 and thus promoting the assembly of the A20/TNFAIP3 ubiquitin-editing complex (composed of A20/TNFAIP3, TAX1BP1, and the E3 ligases ITCH and RNF11) . Therefore, CHUK plays a key role in the negative feedback of NF-kappa-B canonical signaling to limit inflammatory gene activation. As part of the non-canonical pathway of NF-kappa-B activation, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. In turn, these complexes regulate genes encoding molecules involved in B-cell survival and lymphoid organogenesis. Participates also in the negative feedback of the non-canonical NF-kappa-B signaling pathway by phosphorylating and destabilizing MAP3K14/NIK. Within the nucleus, phosphorylates CREBBP and consequently increases both its transcriptional and histone acetyltransferase activities. Modulates chromatin accessibility at NF-kappa-B-responsive promoters by phosphorylating histones H3 at 'Ser-10' that are subsequently acetylated at 'Lys-14' by CREBBP. Additionally, phosphorylates the CREBBP-interacting protein NCOA3. Also phosphorylates FOXO3 and may regulate this pro-apoptotic transcription factor (PubMed:15084260) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

WEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQI

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

84 kDa

Notes

Formerly GWB-ASB704

Specificity

IKK-alpha (Phospho-Thr23) Antibody detects endogenous levels of IKK-alpha only when phosphorylated at Thr23.

NCBI Gene Symbol

CHUK

Host or Source

Rabbit

Protein Name

Inhibitor of nuclear factor kappa-B kinase subunit alpha

Gene Name URL

CHUK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGD2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46697064 1.0 µg DNA

TIGD2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
VPS33A Conjugated Antibody
MBS9451184-01 0.1 mL (Biotin)

VPS33A Conjugated Antibody

Sign In for Pricing
View Details
VPS33A Conjugated Antibody
MBS9451184-02 0.1 mL (AF350)

VPS33A Conjugated Antibody

Sign In for Pricing
View Details
VPS33A Conjugated Antibody
MBS9451184-03 0.1 mL (AF405)

VPS33A Conjugated Antibody

Sign In for Pricing
View Details
VPS33A Conjugated Antibody
MBS9451184-04 0.1 mL (AF488)

VPS33A Conjugated Antibody

Sign In for Pricing
View Details
VPS33A Conjugated Antibody
MBS9451184-05 0.1 mL (AF555)

VPS33A Conjugated Antibody

Sign In for Pricing
View Details