Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATA1 Antibody (Phospho-Ser142)

Product Specifications

CAS Number

9007-83-4

Gene Name

GATA binding protein 1

Gene Aliases

ERYF1; erythroid transcription factor; erythroid transcription factor 1; GATA-1; GATA-binding factor 1; GF1; GF-1; globin transcription factor 1; NFE1; NF-E1; NF-E1 DNA-binding protein; nuclear factor, erythroid 1; transcription factor GATA1; XLANP; XLTDA; XLTT.

Gene ID

2623

Swiss Prot

P15976

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human GATA1 around the phosphorylation site of Ser142.

Target

Transcriptional activator or repressor which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells. Activates the transcription of genes involved in erythroid differentiation of K562 erythroleukemia cells, including HBB, HBG1/2, ALAS2 and HMBS (PubMed:24245781) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPV

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Immunoprecipitation|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

42 kDa

Notes

Formerly GWB-ASB680

Specificity

GATA1 (Phospho-Ser142) Antibody detects endogenous levels of GATA1 only when phosphorylated at Ser142.

NCBI Gene Symbol

GATA1

Host or Source

Rabbit

Protein Name

Erythroid transcription factor

Gene Name URL

GATA1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MgC24975 Antibody
E312577 200 µL

MgC24975 Antibody

Sign In for Pricing
View Details
Ornithine decarboxylase Antibody, mAb, Rabbit
A04730-50 50 µL

Ornithine decarboxylase Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Quick Step Human Galectin-2 ELISA Kit
QS3777Hu-01 48 Tests

Quick Step Human Galectin-2 ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Galectin-2 ELISA Kit
QS3777Hu-02 96 Tests

Quick Step Human Galectin-2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Ribose-5-phosphate isomerase A (rpiA)
MBS1335078-01 0.02 mg (E-Coli)

Recombinant Brucella suis biovar 1 Ribose-5-phosphate isomerase A (rpiA)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Ribose-5-phosphate isomerase A (rpiA)
MBS1335078-02 0.1 mg (E-Coli)

Recombinant Brucella suis biovar 1 Ribose-5-phosphate isomerase A (rpiA)

Sign In for Pricing
View Details