Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Telomeric Repeat Binding Factor 1 Antibody (Phospho-Ser219)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Telomeric repeat binding factor 1

Gene Aliases

HTRF1-AS; NIMA-interacting protein 2; PIN2; telomeric protein Pin2/TRF1; telomeric repeat binding factor (NIMA-interacting) 1; telomeric repeat-binding factor 1; TRBF1; TRF; TRF1; TTAGGG repeat-binding factor 1; t-TRF1.

Gene ID

7013

Swiss Prot

P54274

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human Telomeric Repeat Binding Factor 1 around the phosphorylation site of Ser219.

Target

Binds the telomeric double-stranded 5'-TTAGGG-3' repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded 5'-TTAGGG-3' repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYN

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

50 kDa

Notes

Formerly GWB-ASB588

Specificity

Telomeric Repeat Binding Factor 1 (Phospho-Ser219) Antibody detects endogenous levels of Telomeric Repeat Binding Factor 1 only when phosphorylated at Ser219.

NCBI Gene Symbol

TERF1

Host or Source

Rabbit

Protein Name

Telomeric repeat-binding factor 1

Gene Name URL

TERF1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit
MBS7251892-01 48 Well

Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit
MBS7251892-02 96 Well

Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit
MBS7251892-03 5x 96 Well

Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit

Sign In for Pricing
View Details
Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit
MBS7251892-04 10x 96 Well

Monkey Cysteine-rich protein 1 (CRIP1) ELISA Kit

Sign In for Pricing
View Details
TMEM147 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46904151 3x 1.0 µg DNA

TMEM147 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
ELK3 Rabbit Polyclonal Antibody (Cy7)
orb1065604 100 µL

ELK3 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details