What is the catalog number for NFAT5 Antibody (Phospho-Ser1197)?

The catalog number for NFAT5 Antibody (Phospho-Ser1197) is OAAF07660-100UG.

What sizes are available for NFAT5 Antibody (Phospho-Ser1197)?

NFAT5 Antibody (Phospho-Ser1197) is available in the following size(s): 100 µg.

Is NFAT5 Antibody (Phospho-Ser1197) in stock?

NFAT5 Antibody (Phospho-Ser1197) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

NFAT5 Antibody (Phospho-Ser1197)

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear factor of activated T cells 5

Gene Aliases

Glutamine rich protein H65; NF-AT5; NFATL1; NFAT-like protein 1; NFATZ; nuclear factor of activated T-cells 5; nuclear factor of activated T-cells 5, tonicity-responsive; OREBP; osmotic response element-binding protein; T-cell transcription factor NFAT5; TonE-binding protein; TONEBP; tonicity-responsive enhancer-binding protein.

Gene ID

10725

Swiss Prot

O94916

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human NFAT5 around the phosphorylation site of Ser1197.

Target

Transcription factor involved, among others, in the transcriptional regulation of osmoprotective and inflammatory genes. Mediates the transcriptional response to hypertonicity (PubMed:10051678) . Positively regulates the transcription of LCN2 and S100A4 genes; optimal transactivation of these genes requires the presence of DDX5/DDX17 (PubMed:22266867) . Binds the DNA consensus sequence 5'-[ACT][AG]TGGAAA[CAT]A[TA][ATC][CA][ATG][GT][GAC][CG][CT]-3' (PubMed:10377394) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPP

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol