What is the catalog number for MRE11 Antibody (Phospho-Ser264)?

The catalog number for MRE11 Antibody (Phospho-Ser264) is OAAF07658-100UG.

What sizes are available for MRE11 Antibody (Phospho-Ser264)?

MRE11 Antibody (Phospho-Ser264) is available in the following size(s): 100 µg.

Is MRE11 Antibody (Phospho-Ser264) in stock?

MRE11 Antibody (Phospho-Ser264) is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

MRE11 Antibody (Phospho-Ser264)

Product Specifications

CAS Number

9007-83-4

Gene Name

MRE11 homolog, double strand break repair nuclease

Gene Aliases

ATLD; AT-like disease; DNA recombination and repair protein; double-strand break repair protein MRE11; double-strand break repair protein MRE11A; endo/exonuclease Mre11; HNGS1; meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A; MRE11 double strand break repair nuclease A; MRE11 homolog 1; MRE11 homolog A, double strand break repair nuclease; MRE11 homolog, double strand break repair nuclease A; MRE11 meiotic recombination 11 homolog A; MRE11 meiotic recombination 11-like protein A; MRE11A; MRE11B.

Gene ID

4361

Swiss Prot

P49959

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human MRE11 around the phosphorylation site of Ser264.

Target

Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11 to prevent nucleolytic degradation past a given point (PubMed:9651580, PubMed:9590181, PubMed:9705271, PubMed:11741547) . The complex may also be required for DNA damage signaling via activation of the ATM kinase (PubMed:15064416) . In telomeres the MRN complex may modulate t-loop formation (PubMed:10888888) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEA

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol