Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRE11 Antibody (Phospho-Ser264)

Product Specifications

CAS Number

9007-83-4

Gene Name

MRE11 homolog, double strand break repair nuclease

Gene Aliases

ATLD; AT-like disease; DNA recombination and repair protein; double-strand break repair protein MRE11; double-strand break repair protein MRE11A; endo/exonuclease Mre11; HNGS1; meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A; MRE11 double strand break repair nuclease A; MRE11 homolog 1; MRE11 homolog A, double strand break repair nuclease; MRE11 homolog, double strand break repair nuclease A; MRE11 meiotic recombination 11 homolog A; MRE11 meiotic recombination 11-like protein A; MRE11A; MRE11B.

Gene ID

4361

Swiss Prot

P49959

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human MRE11 around the phosphorylation site of Ser264.

Target

Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11 to prevent nucleolytic degradation past a given point (PubMed:9651580, PubMed:9590181, PubMed:9705271, PubMed:11741547) . The complex may also be required for DNA damage signaling via activation of the ATM kinase (PubMed:15064416) . In telomeres the MRN complex may modulate t-loop formation (PubMed:10888888) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEA

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

80 kDa

Notes

Formerly GWB-ASB575

Specificity

MRE11 (Phospho-Ser264) Antibody detects endogenous levels of MRE11 only when phosphorylated at Ser264.

NCBI Gene Symbol

MRE11

Host or Source

Rabbit

Protein Name

Double-strand break repair protein MRE11

Gene Name URL

MRE11

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5-Hydroxytryptamine Receptor 7 (HTR7) ELISA Kit
RDR-HTR7-Hu-01 96 Tests

Human 5-Hydroxytryptamine Receptor 7 (HTR7) ELISA Kit

Sign In for Pricing
View Details
Human 5-Hydroxytryptamine Receptor 7 (HTR7) ELISA Kit
RDR-HTR7-Hu-02 48 Tests

Human 5-Hydroxytryptamine Receptor 7 (HTR7) ELISA Kit

Sign In for Pricing
View Details
Zbtb25 Mouse Gene Knockout Kit (CRISPR)
KN519602 1 Kit

Zbtb25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WST-3
TRC-W500010-50MG 50 mg

WST-3

Sign In for Pricing
View Details
rac 1-Oleoyl-3-linoleoylglycerol
TRC-O531400-10MG 10 mg

rac 1-Oleoyl-3-linoleoylglycerol

Sign In for Pricing
View Details
Sulforhodamine G *CAS 5873-16-5*
73-AAT 1 g

Sulforhodamine G *CAS 5873-16-5*

Sign In for Pricing
View Details