What is the catalog number for SSB Antibody (Phospho-Ser366)?

The catalog number for SSB Antibody (Phospho-Ser366) is OAAF07645-100UG.

What sizes are available for SSB Antibody (Phospho-Ser366)?

SSB Antibody (Phospho-Ser366) is available in the following size(s): 100 µg.

Is SSB Antibody (Phospho-Ser366) in stock?

SSB Antibody (Phospho-Ser366) is currently made to order / not held in immediate stock. Contact us for lead time.

SSB Antibody (Phospho-Ser366)

Product Specifications

CAS Number

9007-83-4

Gene Name

Small RNA binding exonuclease protection factor La

Gene Aliases

Autoantigen La; La; la autoantigen; La ribonucleoprotein; La ribonucleoprotein domain family, member 3; La/SSB; LARP3; lupus La antigen; lupus La protein; sjoegren syndrome type B antigen; Sjogren syndrome antigen B; SS-B; SS-B/La protein.

Gene ID

6741

Swiss Prot

P05455

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human SSB around the phosphorylation site of Ser366.

Target

Binds to the 3' poly (U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation (PubMed:3192525, PubMed:2470590) . In case of Coxsackievirus B3 infection, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation (PubMed:12384597) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KGNKAAQPGSGKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETD

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol