What is the catalog number for PIP5K Antibody (Phospho-Ser307)?

The catalog number for PIP5K Antibody (Phospho-Ser307) is OAAF07642-100UG.

What sizes are available for PIP5K Antibody (Phospho-Ser307)?

PIP5K Antibody (Phospho-Ser307) is available in the following size(s): 100 µg.

Is PIP5K Antibody (Phospho-Ser307) in stock?

PIP5K Antibody (Phospho-Ser307) is currently made to order / not held in immediate stock. Contact us for lead time.

PIP5K Antibody (Phospho-Ser307)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Phosphoinositide kinase, FYVE-type zinc finger containing

Gene Aliases

1-phosphatidylinositol 3-phosphate 5-kinase; CFD; epididymis luminal protein 37; FAB1; FYVE finger-containing phosphoinositide kinase; HEL37; phosphatidylinositol 3-phosphate 5-kinase type III; phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III; phosphoinositide kinase, FYVE finger containing; PIKfyve; PIP5K; PIP5K3; PIPkin-III; serine-protein kinase PIKFYVE; type III PIP kinase; ZFYVE29; zinc finger, FYVE domain containing 29.

Gene ID

200576

Swiss Prot

Q9Y2I7

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human PIP5K around the phosphorylation site of Ser307.

Target

The PI (3,5) P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns (3,5) P2) . Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVP

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol