Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neutrophil Cytosol Factor 1 Antibody (Phospho-Ser328)

Product Specifications

CAS Number

9007-83-4

Gene Name

Neutrophil cytosolic factor 1

Gene Aliases

47 kDa autosomal chronic granulomatous disease protein;47 kDa neutrophil oxidase factor; CGD1; NADPH oxidase organizer 2; NCF-1; NCF1A; NCF-47K; neutrophil cytosol factor 1; neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1) ; neutrophil NADPH oxidase factor 1; nox organizer 2; NOXO2; nox-organizing protein 2; p47phox; p47-phox; SH3 and PX domain-containing protein 1A; SH3PXD1A.

Gene ID

653361

Swiss Prot

P14598

Reactivity

Bovine|Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Neutrophil Cytosol Factor 1 around the phosphorylation site of Ser328.

Target

NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

44 kDa

Notes

Formerly GWB-ASB549

Specificity

Neutrophil Cytosol Factor 1 (Phospho-Ser328) Antibody detects endogenous levels of Neutrophil Cytosol Factor 1 only when phosphorylated at Ser328.

NCBI Gene Symbol

NCF1

Host or Source

Rabbit

Protein Name

Neutrophil cytosol factor 1

Gene Name URL

NCF1

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFP antibody
10-A05E 1 mg

AFP antibody

Sign In for Pricing
View Details
Bis (pinacolato) diboron
GK6469-5g 5 g

Bis (pinacolato) diboron

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RMR5 Polyclonal Antibody
MBS7186026 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RMR5 Polyclonal Antibody

Sign In for Pricing
View Details
NFYC (NM_001142590) Human Over-expression Lysate
LC428193 20 µg

NFYC (NM_001142590) Human Over-expression Lysate

Sign In for Pricing
View Details
FBG5 (F Box 5, FBG-5, FBG 5, F-box G-domain Protein 5, F-box Only Protein 27, FBXO27, F-box Protein 27, FBX27) (PE)
MBS6452355-01 0.1 mL

FBG5 (F Box 5, FBG-5, FBG 5, F-box G-domain Protein 5, F-box Only Protein 27, FBXO27, F-box Protein 27, FBX27) (PE)

Sign In for Pricing
View Details
FBG5 (F Box 5, FBG-5, FBG 5, F-box G-domain Protein 5, F-box Only Protein 27, FBXO27, F-box Protein 27, FBX27) (PE)
MBS6452355-02 5x 0.1 mL

FBG5 (F Box 5, FBG-5, FBG 5, F-box G-domain Protein 5, F-box Only Protein 27, FBXO27, F-box Protein 27, FBX27) (PE)

Sign In for Pricing
View Details