Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK9 Antibody (Phospho-Thr210)

Product Specifications

CAS Number

9007-83-4

Gene Name

NIMA related kinase 9

Gene Aliases

APUG; LCCS10; NC; NERCC; NERCC1; nercc1 kinase; Never in mitosis A-related kinase 9; NIMA (never in mitosis gene a) - related kinase 9; NimA-related kinase 8; nimA-related protein kinase 9; serine/threonine-protein kinase Nek9.

Gene ID

91754

Swiss Prot

Q8TD19

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human NEK9 around the phosphorylation site of Thr210.

Target

Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression. Phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQG

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

107 kDa

Notes

Formerly GWB-ASB547

Specificity

NEK9 (Phospho-Thr210) Antibody detects endogenous levels of NEK9 only when phosphorylated at Thr210.

NCBI Gene Symbol

NEK9

Host or Source

Rabbit

Protein Name

Serine/threonine-protein kinase Nek9

Gene Name URL

NEK9

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Esrrb Mouse siRNA Oligo Duplex (Locus ID 26380)
SR414416 1 Kit

Esrrb Mouse siRNA Oligo Duplex (Locus ID 26380)

Sign In for Pricing
View Details
RPS29P20 sgRNA CRISPR Lentivector (Human) (Target 2)
K2062003 1.0 µg DNA

RPS29P20 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)
MBS2098848-01 5x 96 Tests

Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)
MBS2098848-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)
MBS2098848-03 10x 96 Tests

Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)
MBS2098848-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Myosin IA (MYO1A) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details