What is the catalog number for NEK9 Antibody (Phospho-Thr210)?

The catalog number for NEK9 Antibody (Phospho-Thr210) is OAAF07637-100UG.

What sizes are available for NEK9 Antibody (Phospho-Thr210)?

NEK9 Antibody (Phospho-Thr210) is available in the following size(s): 100 µg.

Is NEK9 Antibody (Phospho-Thr210) in stock?

NEK9 Antibody (Phospho-Thr210) is currently made to order / not held in immediate stock. Contact us for lead time.

NEK9 Antibody (Phospho-Thr210)

Product Specifications

CAS Number

9007-83-4

Gene Name

NIMA related kinase 9

Gene Aliases

APUG; LCCS10; NC; NERCC; NERCC1; nercc1 kinase; Never in mitosis A-related kinase 9; NIMA (never in mitosis gene a) - related kinase 9; NimA-related kinase 8; nimA-related protein kinase 9; serine/threonine-protein kinase Nek9.

Gene ID

91754

Swiss Prot

Q8TD19

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human NEK9 around the phosphorylation site of Thr210.

Target

Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression. Phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQG

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol