Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEK1/MKK4/JNKK1 Antibody (Phospho-Ser257)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitogen-activated protein kinase kinase 4

Gene Aliases

C-Jun N-terminal kinase kinase 1; dual specificity mitogen-activated protein kinase kinase 4; JNK-activated kinase 1; JNK-activating kinase 1; JNKK; JNKK1; MAP kinase kinase 4; MAPK/ERK kinase 4; MAPKK 4; MAPKK4; MEK 4; MEK4; MKK4; PRKMK4; SAPK/ERK kinase 1; SAPKK1; SAPKK-1; SEK1; SERK1; SKK1; stress-activated protein kinase kinase 1.

Gene ID

6416

Swiss Prot

P45985

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human SEK1/MKK4/JNKK1 around the phosphorylation site of Ser257.

Target

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 seems to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAP

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

44 kDa

Notes

Formerly GWB-ASB530

Specificity

SEK1/MKK4/JNKK1 (Phospho-Ser257) Antibody detects endogenous levels of SEK1/MKK4/JNKK1 only when phosphorylated at Ser257.

NCBI Gene Symbol

MAP2K4

Host or Source

Rabbit

Protein Name

Dual specificity mitogen-activated protein kinase kinase 4

Gene Name URL

MAP2K4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1 (T-Cell Marker) (TCL1/2078), 1mg/mL
BNUM2078-50 1x 50 µL

TCL1 (T-Cell Marker) (TCL1/2078), 1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF647 conjugate, 0.1mg/mL
BNC471680-100 1x 100 µL

CD45RA (Leukocyte Marker) (K4B5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POU4F3 Mouse Monoclonal Antibody [Clone ID: OTI3A12]
CF808731 100 µg

POU4F3 Mouse Monoclonal Antibody [Clone ID: OTI3A12]

Sign In for Pricing
View Details
APOB48R (APOBR) Rabbit Polyclonal Antibody
TA368057 100 µL

APOB48R (APOBR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNK2 Polyclonal Antibody
E-AB-12226-01 20 µL

TNK2 Polyclonal Antibody

Sign In for Pricing
View Details
TNK2 Polyclonal Antibody
E-AB-12226-02 60 µL

TNK2 Polyclonal Antibody

Sign In for Pricing
View Details