Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kv2.1/KCNB1 Antibody (Phospho-Ser567)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Potassium voltage-gated channel subfamily B member 1

Gene Aliases

DEE26; delayed rectifier potassium channel 1; DRK1; Kv2.1; potassium voltage-gated channel subfamily B member 1; potassium voltage-gated channel, Shab-related subfamily, member 1; voltage-gated potassium channel subunit Kv2.1.

Gene ID

3745

Swiss Prot

Q14721

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Kv2.1/KCNB1 around the phosphorylation site of Ser567.

Target

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain, but also in the pancreas and cardiovascular system. Contributes to the regulation of the action potential (AP) repolarization, duration and frequency of repetitive AP firing in neurons, muscle cells and endocrine cells and plays a role in homeostatic attenuation of electrical excitability throughout the brain (PubMed:23161216) . Plays also a role in the regulation of exocytosis independently of its electrical function (By similarity) . Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Homotetrameric channels mediate a delayed-rectifier voltage-dependent outward potassium current that display rapid activation and slow inactivation in response to membrane depolarization (PubMed:8081723, PubMed:1283219, PubMed:10484328, PubMed:12560340, PubMed:19074135, PubMed:19717558, PubMed:24901643) . Can form functional homotetrameric and heterotetrameric channels that contain variable proportions of KCNB2; channel properties depend on the type of alpha subunits that are part of the channel (By similarity) . Can also form functional heterotetrameric channels with other alpha subunits that are non-conducting when expressed alone, such as KCNF1, KCNG1, KCNG3, KCNG4, KCNH1, KCNH2, KCNS1, KCNS2, KCNS3 and KCNV1, creating a functionally diverse range of channel complexes (PubMed:10484328, PubMed:11852086, PubMed:12060745, PubMed:19074135, PubMed:19717558, PubMed:24901643) . Heterotetrameric channel activity formed with KCNS3 show increased current amplitude with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells (By similarity) . Channel properties are also modulated by cytoplasmic ancillary beta subunits such as AMIGO1, KCNE1, KCNE2 and KCNE3, slowing activation and inactivation rate of the delayed rectifier potassium channels (By similarity) . In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Major contributor to the slowly inactivating delayed-rectifier voltage-gated potassium current in neurons of the central nervous system, sympathetic ganglion neurons, neuroendocrine cells, pancreatic beta cells, cardiomyocytes and smooth muscle cells. Mediates the major part of the somatodendritic delayed-rectifier potassium current in hippocampal and cortical pyramidal neurons and sympathetic superior cervical ganglion (CGC) neurons that acts to slow down periods of firing, especially during high frequency stimulation. Plays a role in the induction of long-term potentiation (LTP) of neuron excitability in the CA3 layer of the hippocampus (By similarity) . Contributes to the regulation of glucose-induced action potential amplitude and duration in pancreatic beta cells, hence limiting calcium influx and insulin secretion (PubMed:23161216) . Plays a role in the regulation of resting membrane potential and contraction in hypoxia-treated pulmonary artery smooth muscle cells. May contribute to the regulation of the duration of both the action potential of cardiomyocytes and the heart ventricular repolarization QT interval. Contributes to the pronounced pro-apoptotic potassium current surge during neuronal apoptotic cell death in response to oxidative injury. May confer neuroprotection in response to hypoxia/ischemic insults by suppressing pyramidal neurons hyperexcitability in hippocampal and cortical regions (By similarity) . Promotes trafficking of KCNG3, KCNH1 and KCNH2 to the cell surface membrane, presumably by forming heterotetrameric channels with these subunits (PubMed:12060745) . Plays a role in the calcium-dependent recruitment and release of fusion-competent vesicles from the soma of neurons, neuroendocrine and glucose-induced pancreatic beta cells by binding key components of the fusion machinery in a pore-independent manner (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YNKMAKTQSQPILNTKESAAQSKPKEELEMESIPSPVAPLPTRTEGVIDM

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

95 kDa

Notes

Formerly GWB-ASB514

Specificity

Kv2.1/KCNB1 (Phospho-Ser567) Antibody detects endogenous levels of Kv2.1/KCNB1 only when phosphorylated at Ser567.

NCBI Gene Symbol

KCNB1

Host or Source

Rabbit

Protein Name

Potassium voltage-gated channel subfamily B member 1

Gene Name URL

KCNB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR87 Recombinant Protein (Human)
RP039604 100 µg

GPR87 Recombinant Protein (Human)

Sign In for Pricing
View Details
FIG4 ORF Vector (Human) (pORF)
20556011 1.0 µg DNA

FIG4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal RDH14 Antibody (OTI1A7) [PE/Cy7]
NBP2-73847PECY7 0.1 mL

Mouse Monoclonal RDH14 Antibody (OTI1A7) [PE/Cy7]

Sign In for Pricing
View Details
TRNAC26 sgRNA CRISPR Lentivector (Human) (Target 3)
K2479304 1.0 µg DNA

TRNAC26 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ganoderic acid C1
orb1297368-01 1 mg

Ganoderic acid C1

Sign In for Pricing
View Details
Ganoderic acid C1
orb1297368-02 5 mg

Ganoderic acid C1

Sign In for Pricing
View Details