Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Inositol 1, 4, 5-trisphosphate R1 Antibody (Phospho-Ser1598/1588)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Inositol 1,4,5-trisphosphate receptor type 1

Gene Aliases

ACV; CLA4; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor type 1; INSP3R1; IP3 receptor; IP3 receptor isoform 1; IP3R; IP3R 1; IP3R1; PPP1R94; protein phosphatase 1, regulatory subunit 94; SCA15; SCA16; SCA29; type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor.

Gene ID

3708

Swiss Prot

Q14643

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Inositol 1,4,5-trisphosphate R1 around the phosphorylation site of Ser1598/1588.

Target

Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate (PubMed:27108797) . Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1 (By similarity) . Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQD

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

313 kDa

Notes

Formerly GWB-ASB502

Specificity

Inositol 1,4,5-trisphosphate R1 (Phospho-Ser1598/1588) Antibody detects endogenous levels of Inositol 1,4,5-trisphosphate R1 only when phosphorylated at Ser1598/1588.

NCBI Gene Symbol

ITPR1

Host or Source

Rabbit

Protein Name

Inositol 1,4,5-trisphosphate receptor type 1

Gene Name URL

ITPR1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate
TRC-C555013-50MG 50 mg

2-Cyano-1-ethyl-3-fluoropyridin-1-ium Monoethylsulfate

Sign In for Pricing
View Details
Serum Amyloid A (SAA/326), CF568 conjugate, 0.1mg/mL
BNC680326-500 1x 500 µL

Serum Amyloid A (SAA/326), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat CNTFR/CNTFR-alpha Protein (His Tag)
PKSR030401 100 µg

Recombinant Rat CNTFR/CNTFR-alpha Protein (His Tag)

Sign In for Pricing
View Details
Transferrin Antibody
KC-251-01 50 μL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-251-02 100 µL

Transferrin Antibody

Sign In for Pricing
View Details
Transferrin Antibody
KC-251-03 1 mL

Transferrin Antibody

Sign In for Pricing
View Details