What is the catalog number for STAT5A/B Antibody (Phospho-Ser725/730)?

The catalog number for STAT5A/B Antibody (Phospho-Ser725/730) is OAAF07597-100UG.

What sizes are available for STAT5A/B Antibody (Phospho-Ser725/730)?

STAT5A/B Antibody (Phospho-Ser725/730) is available in the following size(s): 100 µg.

Is STAT5A/B Antibody (Phospho-Ser725/730) in stock?

STAT5A/B Antibody (Phospho-Ser725/730) is currently made to order / not held in immediate stock. Contact us for lead time.

STAT5A/B Antibody (Phospho-Ser725/730)

Product Specifications

CAS Number

9007-83-4

Gene Name

Signal transducer and activator of transcription 5A|signal transducer and activator of transcription 5B

Gene Aliases

Epididymis secretory sperm binding protein; GHISID2; MGF; signal transducer and activator of transcription 5A; signal transducer and activator of transcription 5B; STAT5; transcription factor STAT5B.

Gene ID

6776|6777

Swiss Prot

P42229|P51692

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human STAT5A/B around the phosphorylation site of Ser725/730.

Target

Carries out a dual function: signal transduction and activation of transcription (PubMed:29844444) . Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription. Positively regulates hematopoietic/erythroid differentiation.|Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHV

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol