Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT5A/B Antibody (Phospho-Ser725/730)

Product Specifications

CAS Number

9007-83-4

Gene Name

Signal transducer and activator of transcription 5A|signal transducer and activator of transcription 5B

Gene Aliases

Epididymis secretory sperm binding protein; GHISID2; MGF; signal transducer and activator of transcription 5A; signal transducer and activator of transcription 5B; STAT5; transcription factor STAT5B.

Gene ID

6776|6777

Swiss Prot

P42229|P51692

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human STAT5A/B around the phosphorylation site of Ser725/730.

Target

Carries out a dual function: signal transduction and activation of transcription (PubMed:29844444) . Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription. Positively regulates hematopoietic/erythroid differentiation.|Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHV

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

90 kDa

Notes

Formerly GWB-ASB466

Specificity

STAT5A/B (Phospho-Ser725/730) Antibody detects endogenous levels of STAT5A/B only when phosphorylated at Ser725/730.

NCBI Gene Symbol

STAT5A|STAT5B

Host or Source

Rabbit

Protein Name

Signal transducer and activator of transcription 5A|Signal transducer and activator of transcription 5B

Gene Name URL

STAT5A|STAT5B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSD Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
37898066 1.0 µg DNA

PSD Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2-Piperazinecarboxylic acid, N1-FMOC protected, N4-BOC protected
OR9609 1 Each

2-Piperazinecarboxylic acid, N1-FMOC protected, N4-BOC protected

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rhlB Protein (aa 1-438) (strain ATCC 39541 / Ogawa 395 / O395)
VAng-Cr3240-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae rhlB Protein (aa 1-438) (strain ATCC 39541 / Ogawa 395 / O395)

Sign In for Pricing
View Details
Guinea Pig F box/LRR repeat protein 7 (FBXL7) ELISA Kit
GTR10345100 96 Well

Guinea Pig F box/LRR repeat protein 7 (FBXL7) ELISA Kit

Sign In for Pricing
View Details
Human Putative aquaporin-7-like protein 3 (AQP7P3) ELISA Kit
abx502202 96 Tests

Human Putative aquaporin-7-like protein 3 (AQP7P3) ELISA Kit

Sign In for Pricing
View Details
OGG1 Protein Lysate
OCOA10111-20UG 20 µg

OGG1 Protein Lysate

Sign In for Pricing
View Details