Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smad2/3 Antibody (Phospho-Thr8)

Product Specifications

CAS Number

9007-83-4

Gene Name

SMAD family member 2|SMAD family member 3

Gene Aliases

HMAD-2; hMAD-3; hSMAD2; hSMAD3; HSPC193; HsT17436; JV15-2; JV18; JV18-1; LDS1C; LDS3; MAD homolog 2; MAD homolog 3; mad homolog JV15-2; mad protein homolog; MAD, mothers against decapentaplegic homolog 3; mad3; MADH2; MADH3; MADR2; Mad-related protein 2; mother against DPP homolog 2; mothers against decapentaplegic homolog 2; mothers against decapentaplegic homolog 3; mothers against DPP homolog 3; Sma- and Mad-related protein 2; SMA- and MAD-related protein 3; SMAD family member 2; SMAD family member 3; SMAD, mothers against DPP homolog 2; SMAD, mothers against DPP homolog 3.

Gene ID

4087|4088

Swiss Prot

P84022|Q15796

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Smad2/3 around the phosphorylation site of Thr8.

Target

Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.|Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE

Applications

Enzyme-linked immunosorbent assay|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

48 kDa

Notes

Formerly GWB-ASB461

Fragment

IgG

Specificity

Smad2/3 (Phospho-Thr8) Antibody detects endogenous levels of Smad2/3 only when phosphorylated at Thr8.

NCBI Gene Symbol

SMAD2|SMAD3

Host or Source

Rabbit

Protein Name

Mothers against decapentaplegic homolog 2|Mothers against decapentaplegic homolog 3

Gene Name URL

SMAD2|SMAD3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,6,7-Trichloroquinoline
sc-290557A 500 mg

4,6,7-Trichloroquinoline

Sign In for Pricing
View Details
GluR2/3 Antibody
MBS8586975-01 0.1 mg

GluR2/3 Antibody

Sign In for Pricing
View Details
GluR2/3 Antibody
MBS8586975-02 0.1 mL (AF405L)

GluR2/3 Antibody

Sign In for Pricing
View Details
GluR2/3 Antibody
MBS8586975-03 0.1 mL (AF405S)

GluR2/3 Antibody

Sign In for Pricing
View Details
GluR2/3 Antibody
MBS8586975-04 0.1 mL (AF610)

GluR2/3 Antibody

Sign In for Pricing
View Details
GluR2/3 Antibody
MBS8586975-05 0.1 mL (AF635)

GluR2/3 Antibody

Sign In for Pricing
View Details