What is the catalog number for P57 Kip2 Antibody (Phospho-Thr310)?

The catalog number for P57 Kip2 Antibody (Phospho-Thr310) is OAAF07585-100UG.

What sizes are available for P57 Kip2 Antibody (Phospho-Thr310)?

P57 Kip2 Antibody (Phospho-Thr310) is available in the following size(s): 100 µg.

Is P57 Kip2 Antibody (Phospho-Thr310) in stock?

P57 Kip2 Antibody (Phospho-Thr310) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

P57 Kip2 Antibody (Phospho-Thr310)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cyclin dependent kinase inhibitor 1C

Gene Aliases

BWCR; BWS; cyclin-dependent kinase inhibitor 1C; cyclin-dependent kinase inhibitor 1C (p57, Kip2) ; cyclin-dependent kinase inhibitor p57; KIP2; p57; p57Kip2; WBS.

Gene ID

1028

Swiss Prot

P49918

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human p57 Kip2 around the phosphorylation site of Thr310.

Target

Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol