Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER4 Antibody (Phospho-Tyr1284)

Product Specifications

CAS Number

9007-83-4

Gene Name

Erb-b2 receptor tyrosine kinase 4

Gene Aliases

ALS19; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; human epidermal growth factor receptor 4; p180erbB4; proto-oncogene-like protein c-ErbB-4; receptor tyrosine-protein kinase erbB-4; tyrosine kinase-type cell surface receptor HER4; v-erb-a erythroblastic leukemia viral oncogene homolog 4; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4.

Gene ID

2066

Swiss Prot

Q15303

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human HER4 around the phosphorylation site of Tyr1284.

Target

Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins and EGF family members and regulates development of the heart, the central nervous system and the mammary gland, gene transcription, cell proliferation, differentiation, migration and apoptosis. Required for normal cardiac muscle differentiation during embryonic development, and for postnatal cardiomyocyte proliferation. Required for normal development of the embryonic central nervous system, especially for normal neural crest cell migration and normal axon guidance. Required for mammary gland differentiation, induction of milk proteins and lactation. Acts as cell-surface receptor for the neuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family members BTC, EREG and HBEGF. Ligand binding triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Ligand specificity and signaling is modulated by alternative splicing, proteolytic processing, and by the formation of heterodimers with other ERBB family members, thereby creating multiple combinations of intracellular phosphotyrosines that trigger ligand- and context-specific cellular responses. Mediates phosphorylation of SHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1, leading to the activation of phosphatidylinositol 3-kinase and AKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 and isoform JM-B CYT-1 mediate reorganization of the actin cytoskeleton and promote cell migration in response to NRG1. Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosine that mediates interaction with PIK3R1, and hence do not phosphorylate PIK3R1, do not protect cells against apoptosis, and do not promote reorganization of the actin cytoskeleton and cell migration. Proteolytic processing of isoform JM-A CYT-1 and isoform JM-A CYT-2 gives rise to the corresponding soluble intracellular domains (4ICD) that translocate to the nucleus, promote nuclear import of STAT5A, activation of STAT5A, mammary epithelium differentiation, cell proliferation and activation of gene expression. The ERBB4 soluble intracellular domains (4ICD) colocalize with STAT5A at the CSN2 promoter to regulate transcription of milk proteins during lactation. The ERBB4 soluble intracellular domains can also translocate to mitochondria and promote apoptosis.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPP

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

146 kDa

Notes

Formerly GWB-ASB442

Specificity

HER4 (Phospho-Tyr1284) Antibody detects endogenous levels of HER4 only when phosphorylated at Tyr1284.

NCBI Gene Symbol

ERBB4

Host or Source

Rabbit

Protein Name

Receptor tyrosine-protein kinase erbB-4

Gene Name URL

ERBB4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polr3e sgRNA CRISPR Lentivector set (Mouse)
K4469401 3x 1.0 µg

Polr3e sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CYP2W1 Antibody / Cytochrome P450 2W1
FY13252 100 µg

CYP2W1 Antibody / Cytochrome P450 2W1

Sign In for Pricing
View Details
KRT19P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV766436 1.0 µg DNA

KRT19P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human TXNDC12 protein (C-6His)
CD00746-01 10 µg

Recombinant Human TXNDC12 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human TXNDC12 protein (C-6His)
CD00746-02 50 µg

Recombinant Human TXNDC12 protein (C-6His)

Sign In for Pricing
View Details
PCMV-FCGR1A-λN22-YSA-Puro Plasmid
PVT64128 2 µg

PCMV-FCGR1A-λN22-YSA-Puro Plasmid

Sign In for Pricing
View Details