What is the catalog number for HDAC6 Antibody (Phospho-Ser22)?

The catalog number for HDAC6 Antibody (Phospho-Ser22) is OAAF07571-100UG.

What sizes are available for HDAC6 Antibody (Phospho-Ser22)?

HDAC6 Antibody (Phospho-Ser22) is available in the following size(s): 100 µg.

Is HDAC6 Antibody (Phospho-Ser22) in stock?

HDAC6 Antibody (Phospho-Ser22) is currently made to order / not held in immediate stock. Contact us for lead time.

HDAC6 Antibody (Phospho-Ser22)

Product Specifications

CAS Number

9007-83-4

Gene Name

Histone deacetylase 6

Gene Aliases

CPBHM; HD6; histone deacetylase 6; JM21; PPP1R90; protein phosphatase 1, regulatory subunit 90; tubulin-lysine deacetylase HDAC6.

Gene ID

10013

Swiss Prot

Q9UBN7

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human HDAC6 around the phosphorylation site of Ser22.

Target

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity) . Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKM

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol