What is the catalog number for FAS Antibody (Phospho-Tyr291)?

The catalog number for FAS Antibody (Phospho-Tyr291) is OAAF07562-100UG.

What sizes are available for FAS Antibody (Phospho-Tyr291)?

FAS Antibody (Phospho-Tyr291) is available in the following size(s): 100 µg.

Is FAS Antibody (Phospho-Tyr291) in stock?

FAS Antibody (Phospho-Tyr291) is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

FAS Antibody (Phospho-Tyr291)

Product Specifications

CAS Number

9007-83-4

Gene Name

Fas cell surface death receptor

Gene Aliases

ALPS1A; APO-1; Apo-1 antigen; APO-1 cell surface antigen; apoptosis antigen 1; apoptosis signaling receptor FAS; apoptosis-mediating surface antigen FAS; APT1; CD95; CD95 antigen; Fas (TNF receptor superfamily, member 6) ; Fas AMA; FAS1; FASLG receptor; FASTM; mutant tumor necrosis receptor superfamily member 6; TNF receptor superfamily member 6; TNFRSF6; tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily, member 6.

Gene ID

355

Swiss Prot

P25445

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human FAS around the phosphorylation site of Tyr291.

Target

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTL

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol