What is the catalog number for Elk3 Antibody (Phospho-Ser357)?

The catalog number for Elk3 Antibody (Phospho-Ser357) is OAAF07559-100UG.

What sizes are available for Elk3 Antibody (Phospho-Ser357)?

Elk3 Antibody (Phospho-Ser357) is available in the following size(s): 100 µg.

Is Elk3 Antibody (Phospho-Ser357) in stock?

Elk3 Antibody (Phospho-Ser357) is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Elk3 Antibody (Phospho-Ser357)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

ETS transcription factor ELK3

Gene Aliases

ELK3, ETS transcription factor; ELK3, ETS-domain protein (SRF accessory protein 2) ; ERP; ETS domain-containing protein Elk-3; ETS-related protein ERP; ETS-related protein NET; NET; SAP2; SAP-2; serum response factor accessory protein 2; SRF accessory protein 2.

Gene ID

2004

Swiss Prot

P41970

Reactivity

Human|Monkey|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human Elk3 around the phosphorylation site of Ser357.

Target

May be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SGSLTPAFFTAQTPNGLLLTPSPLLSSIHFWSSLSPVAPLSPARLQGPST

Applications

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol