Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERK3 Antibody (Phospho-Ser189)

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitogen-activated protein kinase 6

Gene Aliases

ERK3; ERK-3; extracellular signal-regulated kinase 3; extracellular signal-regulated kinase, p97; HsT17250; MAP kinase 6; MAP kinase isoform p97; MAPK 6; mitogen-activated protein kinase 6; p97MAPK; p97-MAPK; PRKM6; protein kinase, mitogen-activated 5; protein kinase, mitogen-activated 6.

Gene ID

5597

Swiss Prot

Q16659

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human ERK3 around the phosphorylation site of Ser189.

Target

Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PANLFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

82 kDa

Notes

Formerly GWB-ASB422

Specificity

ERK3 (Phospho-Ser189) Antibody detects endogenous levels of ERK3 only when phosphorylated at Ser189.

NCBI Gene Symbol

MAPK6

Host or Source

Rabbit

Protein Name

Mitogen-activated protein kinase 6

Gene Name URL

MAPK6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zinc finger protein 276 (ZNF276) ELISA Kit
abx554554 96 Tests

Mouse Zinc finger protein 276 (ZNF276) ELISA Kit

Sign In for Pricing
View Details
CASK Rabbit pAb
E45R24792N-100 100 µL

CASK Rabbit pAb

Sign In for Pricing
View Details
gamma TubµLin (TUBG2) Human siRNA Oligo Duplex (Locus ID 27175)
SR309018 1 Kit

gamma TubµLin (TUBG2) Human siRNA Oligo Duplex (Locus ID 27175)

Sign In for Pricing
View Details
Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit
MBS7210729-01 48 Well

Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit

Sign In for Pricing
View Details
Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit
MBS7210729-02 96 Well

Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit

Sign In for Pricing
View Details
Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit
MBS7210729-03 5x 96 Well

Monkey Calcium-responsive transactivator (SS18L1) ELISA Kit

Sign In for Pricing
View Details