What is the catalog number for HER2 Antibody (Phospho-Thr686)?

The catalog number for HER2 Antibody (Phospho-Thr686) is OAAF07555-100UG.

What sizes are available for HER2 Antibody (Phospho-Thr686)?

HER2 Antibody (Phospho-Thr686) is available in the following size(s): 100 µg.

Is HER2 Antibody (Phospho-Thr686) in stock?

HER2 Antibody (Phospho-Thr686) is currently made to order / not held in immediate stock. Contact us for lead time.

HER2 Antibody (Phospho-Thr686)

Product Specifications

CAS Number

9007-83-4

Gene Name

Erb-b2 receptor tyrosine kinase 2

Gene Aliases

CD340; c-erb B2/neu protein; HER2; HER-2; HER-2/neu; herstatin; human epidermal growth factor receptor 2; metastatic lymph node gene 19 protein; MLN 19; NEU; neuro/glioblastoma derived oncogene homolog; neuroblastoma/glioblastoma derived oncogene homolog; NGL; p185erbB2; proto-oncogene c-ErbB-2; proto-oncogene Neu; receptor tyrosine-protein kinase erbB-2; TKR1; tyrosine kinase-type cell surface receptor HER2; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2; v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; VSCN2.

Gene ID

2064

Swiss Prot

P04626

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human HER2 around the phosphorylation site of Thr686.

Target

Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs) . Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQA

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol