Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER2 Antibody (Phospho-Thr686)

Product Specifications

CAS Number

9007-83-4

Gene Name

Erb-b2 receptor tyrosine kinase 2

Gene Aliases

CD340; c-erb B2/neu protein; HER2; HER-2; HER-2/neu; herstatin; human epidermal growth factor receptor 2; metastatic lymph node gene 19 protein; MLN 19; NEU; neuro/glioblastoma derived oncogene homolog; neuroblastoma/glioblastoma derived oncogene homolog; NGL; p185erbB2; proto-oncogene c-ErbB-2; proto-oncogene Neu; receptor tyrosine-protein kinase erbB-2; TKR1; tyrosine kinase-type cell surface receptor HER2; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2; v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; VSCN2.

Gene ID

2064

Swiss Prot

P04626

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human HER2 around the phosphorylation site of Thr686.

Target

Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs) . Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQA

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

137 kDa

Notes

Formerly GWB-ASB421

Specificity

HER2 (Phospho-Thr686) Antibody detects endogenous levels of HER2 only when phosphorylated at Thr686.

NCBI Gene Symbol

ERBB2

Host or Source

Rabbit

Protein Name

Receptor tyrosine-protein kinase erbB-2

Gene Name URL

ERBB2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCS beta 2 Peptide
DF8552-BP 1 mg

GCS beta 2 Peptide

Sign In for Pricing
View Details
Phospho-VIM-S83 pAb
MBS8574627-01 0.1 mL

Phospho-VIM-S83 pAb

Sign In for Pricing
View Details
Phospho-VIM-S83 pAb
MBS8574627-02 0.1 mL (AF405L)

Phospho-VIM-S83 pAb

Sign In for Pricing
View Details
Phospho-VIM-S83 pAb
MBS8574627-03 0.1 mL (AF405S)

Phospho-VIM-S83 pAb

Sign In for Pricing
View Details
Phospho-VIM-S83 pAb
MBS8574627-04 0.1 mL (AF610)

Phospho-VIM-S83 pAb

Sign In for Pricing
View Details
Phospho-VIM-S83 pAb
MBS8574627-05 0.1 mL (AF635)

Phospho-VIM-S83 pAb

Sign In for Pricing
View Details