What is the catalog number for DAPK2 Antibody (Phospho-Ser318)?

The catalog number for DAPK2 Antibody (Phospho-Ser318) is OAAF07541-100UG.

What sizes are available for DAPK2 Antibody (Phospho-Ser318)?

DAPK2 Antibody (Phospho-Ser318) is available in the following size(s): 100 µg.

Is DAPK2 Antibody (Phospho-Ser318) in stock?

DAPK2 Antibody (Phospho-Ser318) is currently made to order / not held in immediate stock. Contact us for lead time.

DAPK2 Antibody (Phospho-Ser318)

Product Specifications

CAS Number

9007-83-4

Gene Name

Death associated protein kinase 2

Gene Aliases

DAP kinase 2; DAP-kinase-related protein 1; death-associated protein kinase 2; DRP1; DRP-1.

Gene ID

23604

Swiss Prot

Q9UIK4

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human DAPK2 around the phosphorylation site of Ser318.

Target

Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Acts as a mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation (PubMed:17347302) . Regulates granulocytic motility by controlling cell spreading and polarization (PubMed:24163421) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

WITPVDNQQAMVRRESVVNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLM

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol