Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calcium Sensing Receptor Antibody (Phospho-Thr888)

Product Specifications

CAS Number

9007-83-4

Gene Name

Calcium sensing receptor

Gene Aliases

CAR; EIG8; extracellular calcium-sensing receptor; FHH; FIH; GPRC2A; hCasR; HHC; HHC1; HYPOC1; NSHPT; parathyroid Ca (2+) -sensing receptor 1; parathyroid cell calcium-sensing receptor 1; PCAR1.

Gene ID

846

Swiss Prot

P41180

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Calcium Sensing Receptor around the phosphorylation site of Thr888.

Target

G-protein-coupled receptor that senses changes in the extracellular concentration of calcium ions and plays a key role in maintaining calcium homeostasis (PubMed:7759551, PubMed:8702647, PubMed:8636323, PubMed:8878438, PubMed:17555508, PubMed:19789209, PubMed:21566075, PubMed:22114145, PubMed:23966241, PubMed:25292184, PubMed:25104082, PubMed:26386835, PubMed:25766501, PubMed:22789683) . Senses fluctuations in the circulating calcium concentration and modulates the production of parathyroid hormone (PTH) in parathyroid glands (By similarity) . The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system (PubMed:7759551) . The G-protein-coupled receptor activity is activated by a co-agonist mechanism: aromatic amino acids, such as Trp or Phe, act concertedly with divalent cations, such as calcium or magnesium, to achieve full receptor activation (PubMed:27434672, PubMed:27386547) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSSSLG

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

120 kDa

Notes

Formerly GWB-ASB360

Specificity

Calcium Sensing Receptor (Phospho-Thr888) Antibody detects endogenous levels of Calcium Sensing Receptor only when phosphorylated at Thr888.

NCBI Gene Symbol

CASR

Host or Source

Rabbit

Protein Name

Extracellular calcium-sensing receptor

Gene Name URL

CASR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxytyrosol Acetate
C17328 25 mg

Hydroxytyrosol Acetate

Sign In for Pricing
View Details
Mouse Protein NDRG3, NDRG3 ELISA Kit
MBS9340275-01 48 Well

Mouse Protein NDRG3, NDRG3 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein NDRG3, NDRG3 ELISA Kit
MBS9340275-02 96 Well

Mouse Protein NDRG3, NDRG3 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein NDRG3, NDRG3 ELISA Kit
MBS9340275-03 5x 96 Well

Mouse Protein NDRG3, NDRG3 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein NDRG3, NDRG3 ELISA Kit
MBS9340275-04 10x 96 Well

Mouse Protein NDRG3, NDRG3 ELISA Kit

Sign In for Pricing
View Details
SMOC1 Protein Vector (Mouse) (pPM-C-His)
PV231969 500 ng

SMOC1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details