Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Actin-pan Antibody (alpha/gamma) Antibody (Phospho-Tyr55/53)

Product Specifications

CAS Number

9007-83-4

Gene Name

Actin alpha 1, skeletal muscle|actin alpha cardiac muscle 1|actin gamma 1|actin gamma 2, smooth muscle

Gene Aliases

ACT; ACTA; ACTA3; ACTC; ACTE; ACTG; actin, alpha cardiac muscle 1; actin, alpha skeletal muscle; actin, cytoplasmic 2; actin, gamma 2, smooth muscle, enteric; actin, gamma-enteric smooth muscle; actin-like protein; ACTL3; ACTSG; Alpha-actin-1; alpha-actin-3; Alpha-cardiac actin; ASD5; ASMA; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoskeletal gamma-actin; DFNA20; DFNA26; epididymis luminal protein 176; Gamma-2-actin; Gamma-actin; HEL-176; LVNC4; MMIHS5; MPFD; NEM1; NEM2; NEM3; nemaline myopathy type 3; SHPM; Smooth muscle gamma-actin; VSCM; VSCM1.

Gene ID

58|70|71|72

Swiss Prot

P63261|P63267|P68032|P68133

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Actin-pan around the phosphorylation site of Tyr55/53.

Target

Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

41 kDa

Notes

Formerly GWB-ASB312

Specificity

Actin-pan (alpha/gamma) (Phospho-Tyr55/53) Antibody detects endogenous levels of Actin-pan only when phosphorylated at Tyr55/53.

NCBI Gene Symbol

ACTA1|ACTC1|ACTG1|ACTG2

Host or Source

Rabbit

Protein Name

Actin, alpha cardiac muscle 1|Actin, alpha skeletal muscle|Actin, cytoplasmic 2|Actin, gamma-enteric smooth muscle

Gene Name URL

ACTA1|ACTC1|ACTG1|ACTG2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details