Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

53BP1 Antibody (Phospho-Ser6)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Tumor protein p53 binding protein 1

Gene Aliases

53BP1; p202; p53-binding protein 1; p53BP1; TDRD30; TP53-binding protein 1; tumor protein 53-binding protein, 1; tumor suppressor p53-binding protein 1.

Gene ID

7158

Swiss Prot

Q12888

Reactivity

Human|Monkey|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human 53BP1 around the phosphorylation site of Ser6.

Target

Double-strand break (DSB) repair protein involved in response to DNA damage, telomere dynamics and class-switch recombination (CSR) during antibody genesis (PubMed:12364621, PubMed:22553214, PubMed:23333306, PubMed:17190600, PubMed:21144835, PubMed:28241136) . Plays a key role in the repair of double-strand DNA breaks (DSBs) in response to DNA damage by promoting non-homologous end joining (NHEJ) -mediated repair of DSBs and specifically counteracting the function of the homologous recombination (HR) repair protein BRCA1 (PubMed:22553214, PubMed:23727112, PubMed:23333306) . In response to DSBs, phosphorylation by ATM promotes interaction with RIF1 and dissociation from NUDT16L1/TIRR, leading to recruitment to DSBs sites (PubMed:28241136) . Recruited to DSBs sites by recognizing and binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub) and histone H4 dimethylated at 'Lys-20' (H4K20me2), two histone marks that are present at DSBs sites (PubMed:23760478, PubMed:28241136, PubMed:17190600) . Required for immunoglobulin class-switch recombination (CSR) during antibody genesis, a process that involves the generation of DNA DSBs (PubMed:23345425) . Participates to the repair and the orientation of the broken DNA ends during CSR (By similarity) . In contrast, it is not required for classic NHEJ and V (D) J recombination (By similarity) . Promotes NHEJ of dysfunctional telomeres via interaction with PAXIP1 (PubMed:23727112) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNL

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

213 kDa

Notes

Formerly GWB-ASB310

Specificity

53BP1 (Phospho-Ser6) Antibody detects endogenous levels of 53BP1 only when phosphorylated at Ser6.

NCBI Gene Symbol

TP53BP1

Host or Source

Rabbit

Protein Name

TP53-binding protein 1

Gene Name URL

TP53BP1

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Myeloid Cell Marker Antibody (SPM298) [Alexa Fluor 350]
NBP2-34759AF350 0.1 mL

Mouse Monoclonal Myeloid Cell Marker Antibody (SPM298) [Alexa Fluor 350]

Ask
View Details
KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP)
MBS6132308-01 0.1 mL

KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP)

Ask
View Details
KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP)
MBS6132308-02 5x 0.1 mL

KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50) (AP)

Ask
View Details
Lentiviral human TMEM63B shRNA (UAS) - Lentiviral human TMEM63B shRNA (UAS) plasmid
GTR15337306 1 Vial

Lentiviral human TMEM63B shRNA (UAS) - Lentiviral human TMEM63B shRNA (UAS) plasmid

Ask
View Details
Recombinant Mouse Proprotein Convertase 9 protein (C-6His)
CD00259-01 10 µg

Recombinant Mouse Proprotein Convertase 9 protein (C-6His)

Ask
View Details
Recombinant Mouse Proprotein Convertase 9 protein (C-6His)
CD00259-02 50 µg

Recombinant Mouse Proprotein Convertase 9 protein (C-6His)

Ask
View Details