Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIE2 Antibody (Phospho-Tyr1102)

Product Specifications

CAS Number

9007-83-4

Gene Name

TEK receptor tyrosine kinase

Gene Aliases

Angiopoietin-1 receptor; CD202B; endothelial tyrosine kinase; GLC3E; p140 TEK; TEK tyrosine kinase, endothelial; TIE2; TIE-2; tunica interna endothelial cell kinase; tyrosine kinase with Ig and EGF homology domains-2; tyrosine-protein kinase receptor TEK; tyrosine-protein kinase receptor TIE-2; VMCM; VMCM1.

Gene ID

7010

Swiss Prot

Q02763

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human TIE2 around the phosphorylation site of Tyr1102.

Target

Tyrosine-protein kinase that acts as cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of proinflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for post-natal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1; SHC1 and TIE1.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGID

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

125 kDa

Notes

Formerly GWB-ASB306

Specificity

TIE2 (Phospho-Tyr1102) Antibody detects endogenous levels of TIE2 only when phosphorylated at Tyr1102.

NCBI Gene Symbol

TEK

Host or Source

Rabbit

Protein Name

Angiopoietin-1 receptor

Gene Name URL

TEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FBXO30 shRNA (UAS) - Lentiviral human FBXO30 shRNA (UAS, GFP) (25)
GTR15138284 1 Vial

Lentiviral human FBXO30 shRNA (UAS) - Lentiviral human FBXO30 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FAM117B CRISPR All-in-one AAV vector set (with saCas9)(Rat)
19730156 3x 1.0 µg DNA

FAM117B CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mouse Monoclonal p27/Kip1 Antibody (SX53G8) [Alexa Fluor 647]
NBP2-34718AF647 0.1 mL

Mouse Monoclonal p27/Kip1 Antibody (SX53G8) [Alexa Fluor 647]

Sign In for Pricing
View Details
AFM Peptide - C-terminal region
MBS3226729-01 0.1 mg

AFM Peptide - C-terminal region

Sign In for Pricing
View Details
AFM Peptide - C-terminal region
MBS3226729-02 5x 0.1 mg

AFM Peptide - C-terminal region

Sign In for Pricing
View Details
Human 5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) ELISA Kit
abx259399-01 96 Tests

Human 5'-AMP-Activated Protein Kinase Subunit Gamma-1 (PRKAG1) ELISA Kit

Sign In for Pricing
View Details