Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myosin regulatory light chain 2 Antibody (Phospho-Ser18)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Interleukin 4 receptor|myosin light chain 9

Gene Aliases

20 kDa myosin light chain; CD124; epididymis secretory sperm binding protein; IL-4 receptor subunit alpha; IL4R nirs variant 1; IL4RA; IL-4RA; interleukin 13 receptor; interleukin-4 receptor alpha chain; interleukin-4 receptor subunit alpha; LC20; MLC2; MLC-2C; MMIHS4; MRLC1; myosin regulatory light chain 1; Myosin regulatory light chain 2, smooth muscle isoform; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light polypeptide 9; myosin RLC; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; MYRL2.

Gene ID

10398|3566

Swiss Prot

P24844

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Myosin regulatory light chain 2 around the phosphorylation site of Ser18.

Target

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKE

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Format

Liquid.// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

Reconstitution

-20°C

Molecular Weight

19 kDa

Notes

Formerly GWB-ASB280

Fragment

IgG

Specificity

Myosin regulatory light chain 2 (Phospho-Ser18) Antibody detects endogenous levels of Myosin regulatory light chain 2 only when phosphorylated at Ser18.

NCBI Gene Symbol

IL4R|MYL9

Host or Source

Rabbit

Protein Name

Myosin regulatory light polypeptide 9

Gene Name URL

IL4R|MYL9

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF647 conjugate, 0.1mg/mL
BNC472990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL
BNC472053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details