Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSK1 Antibody (Phospho-Ser360)

Product Specifications

CAS Number

9007-83-4

Gene Name

Ribosomal protein S6 kinase A5

Gene Aliases

90 kDa ribosomal protein S6 kinase 5; MSK1; MSPK1; nuclear mitogen- and stress-activated protein kinase 1; ribosomal protein S6 kinase alpha-5; ribosomal protein S6 kinase, 90kDa, polypeptide 5; RLPK; RSKL; RSK-like protein kinase; S6K-alpha-5.

Gene ID

9252

Swiss Prot

O75582

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human MSK1 around the phosphorylation site of Ser360.

Target

Serine/threonine-protein kinase that is required for the mitogen or stress-induced phosphorylation of the transcription factors CREB1 and ATF1 and for the regulation of the transcription factors RELA, STAT3 and ETV1/ER81, and that contributes to gene activation by histone phosphorylation and functions in the regulation of inflammatory genes (PubMed:11909979, PubMed:12569367, PubMed:12763138, PubMed:9687510, PubMed:18511904, PubMed:9873047) . Phosphorylates CREB1 and ATF1 in response to mitogenic or stress stimuli such as UV-C irradiation, epidermal growth factor (EGF) and anisomycin (PubMed:11909979, PubMed:9873047) . Plays an essential role in the control of RELA transcriptional activity in response to TNF and upon glucocorticoid, associates in the cytoplasm with the glucocorticoid receptor NR3C1 and contributes to RELA inhibition and repression of inflammatory gene expression (PubMed:12628924, PubMed:18511904) . In skeletal myoblasts is required for phosphorylation of RELA at 'Ser-276' during oxidative stress (PubMed:12628924) . In erythropoietin-stimulated cells, is necessary for the 'Ser-727' phosphorylation of STAT3 and regulation of its transcriptional potential (PubMed:12763138) . Phosphorylates ETV1/ER81 at 'Ser-191' and 'Ser-216', and thereby regulates its ability to stimulate transcription, which may be important during development and breast tumor formation (PubMed:12569367) . Directly represses transcription via phosphorylation of 'Ser-1' of histone H2A (PubMed:15010469) . Phosphorylates 'Ser-10' of histone H3 in response to mitogenics, stress stimuli and EGF, which results in the transcriptional activation of several immediate early genes, including proto-oncogenes c-fos/FOS and c-jun/JUN (PubMed:12773393) . May also phosphorylate 'Ser-28' of histone H3 (PubMed:12773393) . Mediates the mitogen- and stress-induced phosphorylation of high mobility group protein 1 (HMGN1/HMG14) (PubMed:12773393) . In lipopolysaccharide-stimulated primary macrophages, acts downstream of the Toll-like receptor TLR4 to limit the production of pro-inflammatory cytokines (By similarity) . Functions probably by inducing transcription of the MAP kinase phosphatase DUSP1 and the anti-inflammatory cytokine interleukin 10 (IL10), via CREB1 and ATF1 transcription factors (By similarity) . Plays a role in neuronal cell death by mediating the downstream effects of excitotoxic injury (By similarity) . Phosphorylates TRIM7 at 'Ser-107' in response to growth factor signaling via the MEK/ERK pathway, thereby stimulating its ubiquitin ligase activity (PubMed:25851810) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAP

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

89 kDa

Notes

Formerly GWB-ASB276

Specificity

MSK1 (Phospho-Ser360) Antibody detects endogenous levels of MSK1 only when phosphorylated at Ser360.

NCBI Gene Symbol

RPS6KA5

Host or Source

Rabbit

Protein Name

Ribosomal protein S6 kinase alpha-5

Gene Name URL

RPS6KA5

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nunc Stopper for 70x11mm
341866 3600 / PCK

Nunc Stopper for 70x11mm

Ask
View Details
DCT Rabbit pAb
MBS8541044-01 0.1 mL

DCT Rabbit pAb

Ask
View Details
DCT Rabbit pAb
MBS8541044-02 0.1 mL (AF405L)

DCT Rabbit pAb

Ask
View Details
DCT Rabbit pAb
MBS8541044-03 0.1 mL (AF405S)

DCT Rabbit pAb

Ask
View Details
DCT Rabbit pAb
MBS8541044-04 0.1 mL (AF610)

DCT Rabbit pAb

Ask
View Details
DCT Rabbit pAb
MBS8541044-05 0.1 mL (AF635)

DCT Rabbit pAb

Ask
View Details