Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETK Antibody (Phospho-Tyr40)

Product Specifications

CAS Number

9007-83-4

Gene Name

BMX non-receptor tyrosine kinase

Gene Aliases

Bone marrow tyrosine kinase gene in chromosome X protein; BTK-like on X chromosome; cytoplasmic tyrosine-protein kinase BMX; epithelial and endothelial tyrosine kinase; ETK; Etk/Bmx cytosolic tyrosine kinase; NTK38; NTK38 tyrosine kinase; PSCTK2; PSCTK3.

Gene ID

660

Swiss Prot

P51813

Reactivity

Human|Mouse

Immunogen

The antiserum was produced against synthesized peptide derived from human ETK around the phosphorylation site of Tyr40.

Target

Non-receptor tyrosine kinase that plays central but diverse modulatory roles in various signaling processes involved in the regulation of actin reorganization, cell migration, cell proliferation and survival, cell adhesion, and apoptosis. Participates in signal transduction stimulated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors and integrins. Induces tyrosine phosphorylation of BCAR1 in response to integrin regulation. Activation of BMX by integrins is mediated by PTK2/FAK1, a key mediator of integrin signaling events leading to the regulation of actin cytoskeleton and cell motility. Plays a critical role in TNF-induced angiogenesis, and implicated in the signaling of TEK and FLT1 receptors, 2 important receptor families essential for angiogenesis. Required for the phosphorylation and activation of STAT3, a transcription factor involved in cell differentiation. Also involved in interleukin-6 (IL6) induced differentiation. Plays also a role in programming adaptive cytoprotection against extracellular stress in different cell systems, salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. May be involved in regulation of endocytosis through its interaction with an endosomal protein RUFY1. May also play a role in the growth and differentiation of hematopoietic cells; as well as in signal transduction in endocardial and arterial endothelial cells.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSI

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

78 kDa

Notes

Formerly GWB-ASB265

Specificity

ETK (Phospho-Tyr40) Antibody detects endogenous levels of ETK only when phosphorylated at Tyr40.

NCBI Gene Symbol

BMX

Host or Source

Rabbit

Protein Name

Cytoplasmic tyrosine-protein kinase BMX

Gene Name URL

BMX

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glutathione S Transferase Mu 1 (Biotin)
547195 200 µL

Glutathione S Transferase Mu 1 (Biotin)

Ask
View Details
Mouse Ankyrin repeat domain-containing protein 16 (ANKRD16) ELISA Kit
abx501848 96 Tests

Mouse Ankyrin repeat domain-containing protein 16 (ANKRD16) ELISA Kit

Ask
View Details
Isoastragaloside IV
HY-N4214 5 mg

Isoastragaloside IV

Ask
View Details
Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
MBS7022315-01 0.02 mg

Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Ask
View Details
Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
MBS7022315-02 0.1 mg

Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Ask
View Details
Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)
MBS7022315-03 5x 0.1 mg

Recombinant Phascogale tapoatafa NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Ask
View Details