Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trk A Antibody (Phospho-Tyr496)

Product Specifications

CAS Number

9007-83-4

Gene Name

Neurotrophic receptor tyrosine kinase 1

Gene Aliases

Gp140trk; high affinity nerve growth factor receptor; MTC; Neurotrophic tyrosine kinase receptor type 1; neurotrophic tyrosine kinase, receptor, type 1; Oncogene TRK; p140-TrkA; TRK; TRK1; TRK1-transforming tyrosine kinase protein; Trk-A; TRKA; tropomyosin-related kinase A; Tyrosine kinase receptor; tyrosine kinase receptor A.

Gene ID

4914

Swiss Prot

P04629

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Trk A around the phosphorylation site of Tyr496.

Target

Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand (PubMed:1850821, PubMed:1849459, PubMed:1281417, PubMed:8325889, PubMed:15488758, PubMed:17196528, PubMed:27445338) . Can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival (By similarity) . Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation (PubMed:1281417) . Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGA

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

87 kDa

Notes

Formerly GWB-ASB236

Specificity

Trk A (Phospho-Tyr496) Antibody detects endogenous levels of Trk A only when phosphorylated at Tyr496.

NCBI Gene Symbol

NTRK1

Host or Source

Rabbit

Protein Name

High affinity nerve growth factor receptor

Gene Name URL

NTRK1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKAIN4 Human shRNA Plasmid Kit (Locus ID 128414)
TL317840 1 Kit

NKAIN4 Human shRNA Plasmid Kit (Locus ID 128414)

Sign In for Pricing
View Details
TSHZ1 Blocking Peptide
CBP4299-01 1 mg

TSHZ1 Blocking Peptide

Sign In for Pricing
View Details
TSHZ1 Blocking Peptide
CBP4299-02 5 mg

TSHZ1 Blocking Peptide

Sign In for Pricing
View Details
STIM1 Polyclonal Antibody, Cy7 Conjugated
bs-21725R-Cy7 100 µL

STIM1 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
OR13C4 Antibody - middle region
OASG05247-100UL 100 µL

OR13C4 Antibody - middle region

Sign In for Pricing
View Details
Anifrolumab Biosimilar (Monoclonal, IgG1-kappa)
A135098 100 µL

Anifrolumab Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details