Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Progesterone Receptor Antibody (Phospho-Ser294)

Product Specifications

CAS Number

9007-83-4

Gene Name

Progesterone receptor

Gene Aliases

NR3C3; nuclear receptor subfamily 3 group C member 3; PR; progesterone receptor.

Gene ID

5241

Swiss Prot

P06401

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Ser294.

Target

The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as transcriptional activator or repressor.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILP

Applications

Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Western blot

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

98 kDa

Notes

Formerly GWB-ASB211

Specificity

Progesterone Receptor (Phospho-Ser294) Antibody detects endogenous levels of Progesterone Receptor only when phosphorylated at Ser294.

NCBI Gene Symbol

PGR

Host or Source

Rabbit

Protein Name

Progesterone receptor

Gene Name URL

PGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus Aureus rpsL Protein (aa 1-137)
VAng-Cr6175-1mgEcoli 1 mg (E. coli)

Recombinant Staphylococcus Aureus rpsL Protein (aa 1-137)

Sign In for Pricing
View Details
Human HEG1 / Protein HEG homolog 1 ELISA Kit
MBS2905367-01 48 Well

Human HEG1 / Protein HEG homolog 1 ELISA Kit

Sign In for Pricing
View Details
Human HEG1 / Protein HEG homolog 1 ELISA Kit
MBS2905367-02 96 Well

Human HEG1 / Protein HEG homolog 1 ELISA Kit

Sign In for Pricing
View Details
Human HEG1 / Protein HEG homolog 1 ELISA Kit
MBS2905367-03 5x 96 Well

Human HEG1 / Protein HEG homolog 1 ELISA Kit

Sign In for Pricing
View Details
Human HEG1 / Protein HEG homolog 1 ELISA Kit
MBS2905367-04 10x 96 Well

Human HEG1 / Protein HEG homolog 1 ELISA Kit

Sign In for Pricing
View Details
PIK3CB, NT (S139) (PIK3CB, PIK3C1, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit beta) (FITC)
MBS6333984-01 0.2 mL

PIK3CB, NT (S139) (PIK3CB, PIK3C1, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit beta) (FITC)

Sign In for Pricing
View Details